Product
Supplier
Encyclopedia
Inquiry
Home > Specialty Chemicals > LL-37 for Sale > LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

ISO COA TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Reagent Grade

Content:

98%

Port:

shenzhen

Brand:

rxc

Packaging:

5mg/vial, 10vials/box

Price valid (until):

2026-02-23

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Sales manager:Fiona
    whatsapp:+8618526610610
    Email: fiona@tianjintaiheng.com


    Description

    Product Detail  

    Shop Safe shipping NAD for Decelerate aging cas no 53-84-9 with large stock-Detailed Image 1

    Items Specifications

    Product Name   

     LL-37

    CAS 

    154947-66-7
    Molecular Formula C205H340N60O53
    color White
    Form Solid freeze-dried powder
    Storage condition  -20°C
    Purity     99%  
     Packaging Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)  
     Trademark Customzied accepted   
    1. Shop High Quality Raw peptide Powder in stock with Fast Safe Delivery LL37 CAS NO.154947-66-7-Detailed Image 2


      LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing


    Core product advantages:

    1. Human-derived, with extremely high biocompatibility: Derived from human peptides, it has no immunogenicity and is unlikely to cause allergic reactions. It can directly act on sensitive areas such as human mucous membranes and skin.

    2. Multi-functionality, wide application scope: It combines antibacterial, anti-inflammatory, repair, and immune regulation functions. It can achieve "defense + repair" dual effects without the need to combine multiple components.

    3. High purity, easy to prepare: Artificial synthesis can reach a 99% high purity level. The product is in the form of white freeze-dried powder, has good water solubility, and can be used in combination with other peptides and active ingredients.

    4. Safe and residue-free: Different from chemical antibiotics, it can be degraded into amino acids by proteases in the human body and does not cause damage to normal human cells.


    Lipo-C injection contains multiple compounds that may help reduce adipose tissue (fat). This mixture of compounds may be effective individually, but may show greater fat-absorbing activity when used in combination than when used individually. Injecting this mixture of fat-absorbing compounds may be more effective than taking oral supplements due to increased bioavailability from parenteral exposure.


    Shop LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 3

    Product Application

      1. 1. Medical and health field

        Antimicrobial drugs: Used for treating skin infections, mucosal infections, chronic wounds, especially as an alternative treatment for resistant bacterial infections.

        Topical preparations: Formed into ointments, gels, mouthwashes, nasal sprays, etc., directly acting on the infected or inflamed areas, with rapid efficacy.

        Medical material modification: Added to medical dressings, catheters, artificial skin and other material surfaces, giving antibacterial functions and reducing the risk of postoperative infections.

        2. Cosmetics and skincare field

        Functional skin care products: Added to acne-removing products, sensitive skin repair products (anti-inflammatory, repairing the skin barrier), wound care products (accelerating the healing of small wounds), anti-aging products (promoting skin metabolism, improving inflammatory aging).

        Advantages: Gentle and non-irritating, replacing traditional preservatives, antibiotic-type acne-removing ingredients, suitable for long-term use, especially suitable for sensitive skin and acne-prone individuals.

    Shop High Quality Raw peptide Powder in stock with Fast Safe Delivery LL37 CAS NO.154947-66-7-Detailed Image 4

    Peptide Storage Guidelines: General Tips

     


    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements




    Packing


    Product Specifications:

    5mg/vial,10vials/box;

    10mg/vial,10vials/box;

    15mg/vial,10vials/box;

    20mg/vial,10vials/box;

    30mg/vial,10vials/box;

    40mg/vial,10vials/box

    50mg/vial,10vials/box。

    60mg/vial,10vials/box。


    Shop Safe shipping NAD for Decelerate aging cas no 53-84-9 with large stock-Detailed Image 15 Shop Safe shipping NAD for Decelerate aging cas no 53-84-9 with large stock-Detailed Image 16 Shop Safe shipping NAD for Decelerate aging cas no 53-84-9 with large stock-Detailed Image 17

    Shop High Quality Klow blends 80mg high quality 10 vials safe delivery 67727-97-3-Detailed Image 8  Shop High Quality Klow blends 80mg high quality 10 vials safe delivery 67727-97-3-Detailed Image 11

    Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 11

    Shop Safe shipping NAD for Decelerate aging cas no 53-84-9 with large stock-Detailed Image 21

    Shop Factory directly Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss CAS 2023788-19-2-Detailed Image 14

    Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 14 Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 15  

    Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 19

    Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 20


    Our company

    Our company, is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.​

    As a leading peptide manufacturer, our company has a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.​

    In terms of production technology, our company internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.​

    our company adheres to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.​

    our company. will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.


    Shop Factory directly Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss CAS 2023788-19-2-Detailed Image 23

    Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 21 Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 22 Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 23

    Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 24 Shop Factory directly Blue Copper Peptide Powder Ghk-cu Cas 130120-57-9 For Anti-allergic Skin Repair Series-Detailed Image 25

    FAQ

    1. How to preserve peptides after receiving them?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder stored at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
     

    2. What is your lead time and shipping method?
    Customized items are negotiable. 1-3 working day after payment arranges the shipping. Parcels shipping by sea, by air, or by express (EMS, UPS, DHL, TNT, FEDEX, etc).

     

    3. Is the shipping 100% Guarantee?
    Yes, we offer 100% Shipping Guarantee. If any seized parcel we will do resending. 

    4. What payment methods do you support?
     

    Wise/Bank wire/BTC/USTD/alibaba/Paypal


    5. Will I have any side effects after using peptide?
    If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.

    Certificates
    • LL37 CAS NO 154947-66-7 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder Certificates 4

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    peptide

    Location:

    south road and north road

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2022

    Hebei runxuchen trading Co., Ltd. is a modern and advanced enterprise specializing in the production and export of  peptide products, synthetic peptides, cosmetic raw materials, beauty and slimming products etc Products are widely used in health products, peptides and other fields. Our plant covers an area of 1000 m². The proposed workshop will be built according to GMP standards. We provide our customers with quality products and first-class service. Now, we can provide G-KG service to our customers.

    • High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.

    • Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.

    • Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.

    • Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.

    • Comprehensive Product Range: Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.