Top Quality Glucagon Acetate 99% see COA Kanbei kanbei cas 16941-32-5
4 Inquiries
16941-32-5
Industrial Grade
90%
Poti
GUM GUAR
Bulk packaging
2026-03-18
Ethanol,Retatrutide,SLES,Tirzepatide,GHK-CU,Semaglutide
-
Product Description
-
Seller Information
-
Inquiry History
-
Description
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Product features:
Density 1.53± 0.1g /cm3(Predicted)
Storage conditions Keep in dark place,Sealed in dry,2-8°C
Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute. Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
Morphology powder
Why Choose Us
1. Well-equipped, stable and high-quality raw material supply chain, to provide customers with the best quality products.
2.Strict quality inspection process and professional certificate testing to ensure the quality level of the final product.3.Excellent sales team can provide customers with integrated and professional services.4. Accept various OEM & ODM services to meet the different needs of different customers，low MOQ.5. Professional supplier and manufacturer, an integrated enterprise integrating production and sales, providing customers with one-stop service.
FAQ
FAQ
1. Do you accept customization? RE: We can provide corresponding customized solutions according to the specific needs of customers.
2. Can you provide samples? RE: We can provide samples to customers and send them to consumers in time by express.
4. How is your production capacity ?and whether it can meet customer needs in a timely manner. RE:we can produce the products required by customers in time and have sufficient production capacity.
5.How long is your lead time? RE: Within 50kg, can be shipped within 5 days. More than 50 kg, the corresponding time needs to be negotiated according to the weight of the product.
6.What is your terms of payment ? RE: Payment<=1000USD, 100% in advance. Payment>=1000USD, 50% T/T in advance ,balance before shipment. irrevocable LC at sight.
7.Do you have OEM or ODM service of product? Re: Sure. If needed, we can customize products for you.
8.How can you guarantee the goods you offer is qualified ? Re: All the goods are inspected before shipment. If the goods can't come to the quality we promise, you can ask for refund.Product Description
R&D, intermediates.Packing&Delivery
package:1kg small bag &25kg fiber drumdelivery:prompt delivery
Pls iGlucagon is a single-chain polypeptide that contains 29 amino acid residues and has a molecular weight of 3,483. Glucagon is a hormone produced in the pancreas and it is used to raise very low blood sugar. Glucagon is also used in diagnostic testing of the stomach and other digestive organs. Glucagon increases blood glucose concentration and is used in the treatment of hypoglycemia. Glucagon acts only on liver glycogen, converting it to glucose. Glucagon administered through a parenteral route relaxes smooth muscle of the stomach, duodenum, small bowel, and colon.nput...
Items Specifications Cas 16941-32-5
Content 99
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Basic Info-
Product Name:
Glucagon
Other Name:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS No.:16941-32-5
Molecular Formula:C153H225N43O49S
InChIKeys:MASNOZXLGMXCHN-ZLPAWPGGSA-N
Molecular Weight:3482.75
Exact Mass:3480.615723
EC Number:232-708-2
HScode:2937190000
Categories:
Characteristics-
PSA:
1564.04000
XLogP3:-6.01
Appearance:powder
Density:1.53±0.1 g/cm3(Predicted)
Refractive Index:1.682
Water Solubility:Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
Storage Conditions:−20°C
Hazard IdentificationClassification of the substance or mixture
Skin sensitization, Category 1
Acute toxicity - Category 4, Inhalation
Respiratory sensitization, Category 1
GHS label elements, including precautionary statements
Pictogram(s) 
Signal word Danger
Hazard statement(s) H317 May cause an allergic skin reaction
H332 Harmful if inhaled
H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled
Precautionary statement(s) Prevention P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P272 Contaminated work clothing should not be allowed out of the workplace.
P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
P271 Use only outdoors or in a well-ventilated area.
P284 [In case of inadequate ventilation] wear respiratory protection.
Response P302+P352 IF ON SKIN: Wash with plenty of water/...
P333+P317 If skin irritation or rash occurs: Get medical help.
P321 Specific treatment (see ... on this label).
P362+P364 Take off contaminated clothing and wash it before reuse.
P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.
P317 Get medical help.
P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.
Storage none
Disposal P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.
Other hazards which do not result in classification
no data available
Handling and StoragePrecautions for safe handling
Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.
Conditions for safe storage, including any incompatibilities
Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.
-
-
Seller Information
-
Business Type:
Distributor
-
Main Products:
Ethanol,Retatrutide,SLES,Tirzepatide,GHK-CU,Semaglutide
-
Location:
Georgia, Tbilisi, Samgori district, police lane I, N5, floor 2, apartment N 4a
-
Payment Terms:
TT against copy of documents,D/P,TT against B/L draft before shipment,100% TT in advance
-
Average lead Time:
10
-
Total Annual Revenue:
$1 million-$2.5 million
-
Total Employees:
11-50
-
Year of Establishment:
2017
, Manufacturing and Preparation of Chemical Product. We have a strong R & D and production capacity, mainly engaged in the manufacture and sales of agricultural, industrial and life related chemicals. Leading part of Europe, Russia and North America.
-
-
Inquiry History4 Inquiries
Country Product Purchase Quantity Date Posted 
Belgium
Glucagon 16941-32-5 Pharmaceutical grade
10 PCS Jan 8, 2026
Belgium
Glucagon (1-29)
5 MG Jan 9, 2026 
Netherlands
glucagon
1000 KG Feb 15, 2024 
Bulgaria
Glucagon, not retatrutide, just glucagon
1 G May 10, 2026 Post an enquiry for this product
More Choices Find All Products for Sale
| Product Name | Grade / Content | Price | Supplier Name | Details |
|---|---|---|---|---|
| Manufacturer Supplying High Quality API powder Glucagon HCL with 16941-32-5 | Food grade/99 | Hainan Flying International Trade Co., L | Inquiry | |
| Glucagon Acetate 98% white powder cas 16941-32-5 | Cosmetics Grade/95 | $100/MT FOB | Chengdu Jinglin Biotechnology Co., Ltd. | Inquiry |
| Glucagon Hydrochloride | Research and Industrial Grade/98.00 | Hangzhou Go Top Peptide Biotech Co.,Ltd. | Inquiry | |
| Glucagon 16941-32-5 | Reagent Grade/98 | $900-1000/G FOB | cellmano peptide | Inquiry |
| Glucagon Acetate 98% white powder cas 16941-32-5/ Youngshe | Chemical Grade/98 | $20-25/UNIT FOB | Youngshe | Inquiry |