Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - large image1
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - image1
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - image2
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - image3
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - image4
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - image5
Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier buy - image6

Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier

TDS 9 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hongkong

Brand:

LN

Packaging:

10mg/vial; 10vials/kit

Price valid (until):

2026-05-10

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,Retatrutide,Pharmaceutical Peptide,Cosmetic peptide,Custom peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name:Teriparatide 10mg

    CAS No.: 52232-67-4

    Purity: >99% (or refer to the Certificate of Analysis)

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Teriparatide is a recombinant human parathyroid hormone fragment (1-34) and potent anabolic bone agent. Presented as a white to off-white lyophilized powder with ≥98% purity (HPLC), it stimulates osteoblast activity, increases bone mineral density, and reduces fracture risk in osteoporosis. Soluble in aqueous solutions, stable at 2–8°C. Widely used in research and clinical studies for bone metabolism, osteoporosis, and fracture healing. For laboratory and pharmaceutical research only.


    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.


    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

    Items Specifications
    CAS 52232-67-4
    Shelf life >2 years if stored properly
    Appearance Powder
    Purity >99%  (or refer to the Certificate of Analysis)
    Transportation By Air
    Origin China
    Specification 10mg/vial, 10vial/kit
    Storage condition Dry, dark, low temperature


    Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 1 Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 2 Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 3

    Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 4

    Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 5 Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 6


      Advantage  


    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity, ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 7


      Global Service















    Who We Serve


    -We proudly work with clients across North America, Europe, Asia, and Latin America, including:

    -Biotech and pharma firms

    -Research institutions & universities

    -Peptide formulation startups

    -CDMOs and CRO partners

    Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 8


       About Us  


    We are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.


    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.


    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

    Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 9 Shop Teriparatide 10mg 15+yeras API, Raw, Peptide factory supplier-Detailed Image 10


      FQA


    1. How to make an order?

    Send me message and let me know what you need with quantity , then i will calculate to you.


    2. What's the lead time and shipping ways?

    We will delivery to the package by USPS, FEDEX, DHL paket and UPS express to you after receive your payment, it would take around 5-15 days to your address.


    3. How do i keep the peptides when I receive it ?

    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Certificates

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,Retatrutide,Pharmaceutical Peptide,Cosmetic peptide,Custom peptides

    Location:

    Room 1502, Unit 3, Building 2, Nanshan Garden, Jianye 2nd Road, Guodu Subdistrict, Chang'an District, Xi'an City, Shaanxi Province, P.R.China

    Total Employees:

    101-200

    Year of Establishment:

    2017

    LN is a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.

    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.

    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

  • Inquiry History
    9 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.