Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - large image1
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - image1
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - image2
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - image3
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - image4
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - image5
TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK buy - image6

TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK

TDS 9 Inquiries

Unit Price:

$4-5/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99.87%

Port:

hongkong

Brand:

Customization Available

Packaging:

5mg*1vials/box,10mg*1vials/box,15mg*1vials/box,20mg*1vials/box,30mg*1vials/box,

Price valid (until):

2026-07-05

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    contact information:

    Name: Anna

    Email address : xiaobo19872026@outlook.com

    Whatsapp : +85244588108

                           +8613180089301

    Telegram : @anna20260512



    Items Specifications

    Appearance  White lyophilized powder 

    ≥99%White lyophilized

    Unit Size  10mg/vial 

    powder 10mg/vial

    Package  10 vials/box

    10 vials/box

    Storage Condition 2-8°C, dry, avoid light 

    2-8°C, dry, avoid light

    Shelf Life  24 months

    24 months

    Test Method  HPLC, MS

    HPLC, MS


    Shop TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK-Detailed Image 1


    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides,  peptide for weight management, peptide supplements for metabolic health
    Customizable peptide
    Skin care peptide
    Beauty peptide
    Muscle building peptide
    Hair growth peptide
    Weight loss peptide
    Fitness peptide

    Company Profile

    Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

    Shop TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK-Detailed Image 2

       Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 4 Shop TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK-Detailed Image 4 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 5 Shop TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK-Detailed Image 6 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 7 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 8 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 9 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 10 Shop TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK-Detailed Image 11 Shop TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK-Detailed Image 12 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 12  Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 14 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 15

    Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 16

    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future


    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.


    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal


    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.


    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.


    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. 


    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

    Certificates
    • TR PeTR Peptide Raw Materials | 99% purity, Chinese factory. Various peptide types. RT DSZP SM COR SUR TB500 SK Certificates 1

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    9 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.