Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 China Most Professional Factory Supply High Qulity
LL37 China Most Professional Factory Supply High Qulity buy - large image1
LL37 China Most Professional Factory Supply High Qulity buy - image1
LL37 China Most Professional Factory Supply High Qulity buy - image2
LL37 China Most Professional Factory Supply High Qulity buy - image3
LL37 China Most Professional Factory Supply High Qulity buy - image4
LL37 China Most Professional Factory Supply High Qulity buy - image5
LL37 China Most Professional Factory Supply High Qulity buy - image6

LL37 China Most Professional Factory Supply High Qulity

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

Shengyufan International Trade Co., Ltd.

Packaging:

sealed foil bag

Price valid (until):

2026-06-19

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cosmetic raw material,API,Retatrutide,Tirzepatide,Semaglutide,intermediates

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    High Purity Research Peptide Powder LL37


    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 1


    Items Specifications
    Product name LL37
    Specification 10 vials in a box
    Apperance 99%

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 2

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 3 Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 4



      About us


    We are dedicated to providing high-quality peptides at favorable prices.our products exported to over 60 countries and regions around the world, such as the United States, the European Union, the Middle East, Southeast Aisa and South America.
    At the heart of our success is our dedication to building long-term partnerships based on trust, mutual respect, and shared success. Our team of experienced sales and technical professionals works closely with customers to provide personalized solutions, from product selection and customization to technical support and after-sales service. We offer flexible ordering options, competitive pricing, and reliable delivery to ensure that our customers receive the products they need when they need them. Our global distribution network is supported by strategic partnerships with good logistics providers, allowing us to ship products efficiently and safely to destinations around the world. Whether it's a small order or a large-scale shipment, we handle every transaction with the same level of care and attention to detail.

    Constantly strive for high quality products, competitive prices, professional support, effective team, honest cooperation, safe shipment and good after-sales work. Looking forward to build long-term relationship with you.Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 5

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 6

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 7

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 8



       Package and Delivery


    Product Packing: 10 vials in a box (Customized size,label, box according to customer's requirements)

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years), after reconstitution, refrigerate at 2–8 °C (35.6–46.4 °F) and use within 2–4 weeks.

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 9

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 10

    Shop High Purity Research Peptide Powder 5mg Vial Retatrutide-Detailed Image 11



      FAQ


    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email.

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price.

    Q4: Do you accept VISA business credit card?

    A: Sorry we don't accept VISA credit card,
    We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel lose.
    Our long association with our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    But in spite of our best efforts it is still possible will seize a small number of packages.
    In this circumstance we promise reship free to establish long term relationship.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cosmetic raw material,API,Retatrutide,Tirzepatide,Semaglutide,intermediates

    Location:

    3-1-203 Green Home, No.1 Jianming South Road, Chang'an District, Shijiazhuang City, Hebei Province

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Employees:

    5-10

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.