Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 high purity more than 99% safe delivery from china peptide exporter
LL37 high purity more than 99% safe delivery from china peptide exporter buy - large image1
LL37 high purity more than 99% safe delivery from china peptide exporter buy - image1
LL37 high purity more than 99% safe delivery from china peptide exporter buy - image2
LL37 high purity more than 99% safe delivery from china peptide exporter buy - image3
LL37 high purity more than 99% safe delivery from china peptide exporter buy - image4
LL37 high purity more than 99% safe delivery from china peptide exporter buy - image5
LL37 high purity more than 99% safe delivery from china peptide exporter buy - image6

LL37 high purity more than 99% safe delivery from china peptide exporter

1 Inquiries

Unit Price:

$1/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHANGHAI

Brand:

JL

Packaging:

10vials per box

Price valid (until):

2027-08-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp:+85293764717

    WhatsApp:+85293764717

    WhatsApp:+85293764717

    Key Specifications/ Special Features:

    We firmly believe that this freeze-dried powder boasts unparalleled comprehensive advantages in terms of quality, performance and value. If you have any questions about this product or want to know how it can add value to your business, please feel free to contact us at any time. We are always committed to providing excellent customer service to help our clients achieve their business goals.

    Peptide Form Peptide Form
    Peptide Package 10 Vials per box
    Peptide Purity 99%
    MOQ 1 Box

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 1
    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 2


    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 3
    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 4


    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 5
    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 6


    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 7
    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 8


    • Company Profile

    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 9

    Shop Tirzepatide  TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60 TR80 TR100 TR120-Detailed Image 10

    Why choose us:

    1. All peptides and raws purity >=99% purity

    2. 100% Safe delivery

    3.Reasonable & competitive price, fast lead time.

    4.Faster delivery:Sample order in stock and one week for bulk production.

    5. Any inquiries will be replied within 24 hours.


    Our Advantage :

    1. Product Quality Assurance: We maintain stringent quality standards. Contact us for quality-related issues.

    2. Returns and Refunds: Notify us of damaged or incorrect products. Refer to our Returns and Refunds Policy.

    3. Technical Support: Reach our technical support team for assistance.

    4. Order Tracking: Receive tracking information for your order.

    5. Customer Feedback: Share your feedback with us.

    6. Updates and Notifications: Subscribe to our newsletter for updates.


    FAQ:

    Q: How about the price? Can you make it cheaper?

    A: We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q. What's the lead time and shipping ways?

    A: We will delivery to the package by USPS, FEDEX, DHL paket and other dedicated transportation to you after receive your payment, it would take around 10-15 workdays to your address.

    Q: What's the payment methods?

    A: We could accept pay through Alipay Bank Transfer,Paypal,X-Transfer and Bitcoin etc.

    Q: How do i keep the peptides when i receive it ?

    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Items Specifications
    product name  LL37
    appearance powder
    purity 99%

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.