Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Antifoaming > LL-37 for Sale > LL37 CAS154947-66-7 375 BC5 BC10 BC20 price moderate The best price
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - large image1
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - image1
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - image2
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - image3
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - image4
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - image5
LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price buy - image6

LL37 CAS154947-66-7 375 BC5 BC10 BC20 price moderate The best price

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

SC

Packaging:

10 mg / 15mg/ 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-07-22

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Sales manager: Freya

    WhatsApp:+85244869948

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 1

    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 2

    FAQ
    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 3

    FAQ

    1. About Our Company
    Q: Are you a direct manufacturer or a distributor? A: We operate as both—a certified peptide manufacturer and global supplier, ensuring quality control from production to delivery.

    2. Payment Options
    Q: Which payment methods do you support? A: We accept multiple secure options, including cryptocurrency (BTC/USDT), international wire transfers, and traditional remittance services.

    3. Shipping & Delivery
    Q: What is the estimated delivery time? A: Orders are typically delivered within 7-15 working days via express couriers (DHL/UPS/FedEx) or air freight. Sea shipping is available for bulk orders.

    4. Logistics Partners
    Q: Which carriers do you work with? A: We partner with major logistics providers (EMS, TNT, China Air Post) and accommodate custom freight requests.

    5. Order Quantity

    Q: Is there a minimum order requirement? A: Standard products start at 1 box; customized peptides require 10-50 boxes (MOQ varies by formulation).

    6. Bulk Pricing
    Q: Do you offer discounts for large orders? A: Yes—contact us for tiered pricing based on volume.

    7. Custom Branding

    Q: Can I add my logo to the packaging? A: Absolutely. Submit your logo design (AI/vector file), and we’ll provide a mockup for approval.

    8. Global Reach

    Q: Where do you export to? A: We serve clients worldwide, complying with international shipping regulations.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 4

    Introduction

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 5

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 6

    Key Specifications/ Special Features:
    As a leading peptide manufacturing powerhouse, we specialize in producing high - quality peptides with unmatched precision and consistency. Our state - of - the - art facilities are equipped with advanced synthesis and purification technologies, ensuring that each peptide product meets the highest industry standards. Whether it's pharmaceutical - grade peptides for research and development, functional peptides for nutraceuticals, or cosmeceutical peptides for skincare applications, we offer a comprehensive range of solutions.

    We also offer a wide variety of peptide types, such as oligopeptides, polypeptides, and modified peptides. Oligopeptides, with their small molecular size, are highly absorbable and ideal for applications where rapid penetration and bioavailability are crucial, like in dietary supplements aimed at boosting immune function or promoting muscle recovery. Polypeptides, on the other hand, are well - suited for complex biological functions and are frequently used in the development of therapeutic drugs. Modified peptides, which can be customized with specific chemical groups, open up new possibilities for targeted drug delivery and enhanced stability.

    Our production process adheres to strict quality control protocols, from raw material sourcing to final product packaging. With a team of experienced scientists and technicians, we can customize peptide sequences according to specific client requirements, providing tailor - made solutions for diverse industries. Our commitment to innovation, reliability, and customer satisfaction makes us the preferred partner for all your peptide manufacturing needs.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 7

    Shipping Information
    Weight per Unit 24.0 Grams Dimensions per Unit 12.0 x 25.0 x 12.0 Centimeters
    Units per Export Carton 1.0 Export Carton Dimensions L/W/H 11.0 x 22.0 x 44.0 Centimeters
    Export Carton Weight 1.0 Grams

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 8

    Packaging
    Packing:We will pack our products tightly to ensure that they are not damaged in trasit.


    Delivery:Wehave good cooperation with many prodessional forwarders.We can send the products to you once you confrim the order.

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 9

    Main Export Markets

    Main Export Markets
    Asia, 
    Australasia, 
    Central/South America, 
    Eastern Europe, 
    Mid East/Africa, 
    North America, 
    Western Europe


    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 10 Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 11 Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 12

    Payment Details
    Payment Method PayPal

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 13

    Transportation

    Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 14 Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 15 Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 16 Shop LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price-Detailed Image 17


    Certificates
    • LL37 CAS154947-66-7 375  BC5 BC10 BC20 price moderate The best price Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Antifoaming

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.