Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - large image1
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - image1
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - image2
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - image3
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - image4
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - image5
LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer buy - image6

LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 milligrams. 10 bottles per box

Price valid (until):

2027-03-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


       Product Detail  


    Sales manager: Sofia

    WhatsApp:+85293652837

    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 1

    ——      FAQ     ——

    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd like

    Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 2

    ——      Why Choose Us    ——

    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 3

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 4

    ——      Our advantage    ——

    We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

    Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 5 Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 6 Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 7 Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 8

    ——       Our factory      ——

    Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 9

    ——      Packing & Delivery     ——Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 10 Shop LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer-Detailed Image 11

    Certificates
    • LL37 CAS154947-66-7 375 Quality guarantee The straight hair products of the manufacturer Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.