Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Skin Cleansing > LL-37 for Sale > KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - large image1
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - image1
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - image2
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - image3
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - image4
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - image5
KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory buy - image6

KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2026-12-25

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Hailey
    WhatsApp: +852 4481 4820

    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 1

    FAQ:

    Q1. How do you ensure product quality?
    A: We have a strict quality management system, all batches must be tested and meet our standards before entering the warehouse. The purity of all our products is above 99.00%, which has been verified by many American and European customers.
     
     
    Q2. How to place an order with you?
    A: After confirming the dosage/strength and quantity of the required product with the customer, our business personnel will make a Proforma Invoice or Sales Contract. After the customer confirms and pays for the order, we will arrange shipment for the customer as soon as possible.
     
     
    Q3. What payment methods are there?
    A: There are Bank Transfer, PayPal, Tether USD(USDT) and MoneyGram; we can also accept payments in CNY, for example, through Alipay or WeChat.
     
     
    Q4. What shipping methods can we choose?
    A: Usually express delivery is more suitable, including DHL, FedEx, UPS, etc. For Russia, we also have a dedicated express channel (double customs clearance). We will be responsible for customs clearance in the destination country, and customers are not required to cooperate with customs clearance and pay any tariffs.

    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 2
    Product name Customize Peptides
    Purity 99%
    Appearance White powder
    Application Healthcare
    Package Each box contains 10 small bottles
    Storage Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture.
    Retest Date 2 years
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 3

    Professional manufacturing plant
                It has established strict management systems and scientific production processes. It can synthesize thousands of substances.
                It also possesses multiple peptides of different sequences, significantly reducing the overall cost of peptide synthesis. Therefore, we can provide cost-effective products and services to research users, offer valuable research time to customers, and reduce their research costs. Our factory area is 1,500 square meters and has approximately 250 employees. We have product certifications such as FDA and CE.

    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 4                           1.We are very experienced with this field(more than 10 years);
                              2.Good after-sales service
                              3.100% quality guaranteed;
                              4.We accept sample order for testing;
                              5.Strong supply ability
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 5

    FAQ
    Q1.Can I have a sample order?

                       A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

                     A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

                             A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

          A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

                            A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

                 A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

                        A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 6

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 7
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 8
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 9
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 10
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 11
    Shop KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory-Detailed Image 12

    Certificates
    • KissPeptin-10 RT5 RT10 RT15 RT20 RT30 RT40 CAS154947-66-7 High quality source factory Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Skin Cleansing

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.