Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375 CU50 CU100 CAS154947-66-7 Quick inventory delivery
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - large image1
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - image1
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - image2
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - image3
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - image4
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - image5
TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery buy - image6

TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375 CU50 CU100 CAS154947-66-7 Quick inventory delivery

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg / 10 mg / 50mg / 100mg. 10 bottles per box

Price valid (until):

2027-09-30

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 1 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 2

    ——      Why Choose Us      ——

    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the produc

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 3

    ——      Our advantage    ——

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 4

    —— Storage Conditions ——

    Should be stored in the refrigerator at 2°C to 8°C, away from light.

    If required, each single-dose pen can be stored unrefrigerated at a temperature not exceeding 30°C for up to 21 days, but once stored at room temperature it should not be returned to the refrigerator. If not used within 21 days after removal from the refrigerator, it should be discarded. Do not freeze tilpotide and if frozen, do not use.

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 5 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 6 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 7

    ——       Our factory      ——

    At the core of our operations is the unwavering commitment to our guiding principles : "Quality First, Service Supreme."Our mission is to spearhead advancements in biotechnology by consistently upholding the highest standards of quality and service. Through innovation and excellence, we aim to contribute to the betterment of global health and well-being.

    Our primary focus encompasses a range of products , including weight loss peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Tirzepatide, Retatrutide, and others.Provides reliable and timely custom manufacturing services for API following stringent quality system and close communication with the Clients.We have professional sales team , focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market, our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.

    With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers .

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 8 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 9 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 10

    ——        Customer Feedback       ——

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 11 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 12

    ——      Packing & Delivery     ——

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
    2. We will reply you for your inquiry in 24 hours;
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery.

    Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 13 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 14 Shop AP5 G5K G10K Thymalin 10mg Adipotide HCG The straight hair products of the manufacturer-Detailed Image 15

    Welcome to be our distinguished customer

    please do not hesitate to contact us!

    Certificates
    • TB500 Thymosin B4 Acetate BT5 BT10 LL37 GHK-CU 375  CU50 CU100 CAS154947-66-7 Quick inventory delivery Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.