Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Skin Humectant > LL-37 for Sale > 99% LL37 , Raw, Peptide factory supplier
99% LL37 , Raw, Peptide factory supplier buy - large image1
99% LL37 , Raw, Peptide factory supplier buy - image1
99% LL37 , Raw, Peptide factory supplier buy - image2
99% LL37 , Raw, Peptide factory supplier buy - image3

99% LL37 , Raw, Peptide factory supplier

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Port:

Chinese Mainland

Packaging:

5 mg/vial 10vial/kits

Price valid (until):

2026-07-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: LL37 5mg

    CAS No.: 154947-66-7

    Purity: >99% (or refer to the Certificate of Analysis)

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.
    CAS Number: 154947-66-7
    It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.


    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

    Items Specifications






    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Skin Humectant

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

    Location:

    Room 1002-C3973, No. 80, Yongtai Modaonan Street, Yongping Subdistrict, Baiyun District, Guangzhou City

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    45

    Year of Establishment:

    2026

    Anymang is a US-based trading company dedicated to the global supply and formulation of high-quality cosmetic raw materials, with a core focus on peptide ingredients. Committed to bridging premium suppliers and beauty manufacturers worldwide, we deliver pure, stable, and efficacious peptides—including anti-aging, brightening, and firming peptides—alongside a full spectrum of cosmetic actives and custom formulation solutions. With rigorous quality control and compliance with US safety standards, we ensure consistent batch quality and reliable delivery. Our experienced team provides professional technical support and tailored services to help clients develop competitive skincare and personal care products. Trusted by partners across the globe, Anymang stands as your dependable partner for innovative, high-performance cosmetic raw materials and peptide formulations.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.