 Home > Cosmetic Ingredient > Skin Humectant > LL-37 for Sale > 99% LL37 , Raw, Peptide factory supplier

99% LL37 , Raw, Peptide factory supplier buy - large image1

99% LL37 , Raw, Peptide factory supplier buy - image1

99% LL37 , Raw, Peptide factory supplier

1 Inquiries

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Port:

Chinese Mainland

Packaging:

5 mg/vial 10vial/kits

Price valid (until):

2026-07-04

Contact Supplier

 Chat Now

Guangzhou Anymang Technology Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Name: LL37 5mg

CAS No.: 154947-66-7

Purity: >99% (or refer to the Certificate of Analysis)

Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

Shelf Life: >2 years if stored properly

Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.

CAS Number: 154947-66-7

It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

Production：
Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.

NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

Items Specifications

Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Skin Humectant

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water
Seller Information

Business Type:
Trader

Main Products:
Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

Location:
Room 1002-C3973, No. 80, Yongtai Modaonan Street, Yongping Subdistrict, Baiyun District, Guangzhou City

Payment Terms:
TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
45

Year of Establishment:
2026

Anymang is a US-based trading company dedicated to the global supply and formulation of high-quality cosmetic raw materials, with a core focus on peptide ingredients. Committed to bridging premium suppliers and beauty manufacturers worldwide, we deliver pure, stable, and efficacious peptides—including anti-aging, brightening, and firming peptides—alongside a full spectrum of cosmetic actives and custom formulation solutions. With rigorous quality control and compliance with US safety standards, we ensure consistent batch quality and reliable delivery. Our experienced team provides professional technical support and tailored services to help clients develop competitive skincare and personal care products. Trusted by partners across the globe, Anymang stands as your dependable partner for innovative, high-performance cosmetic raw materials and peptide formulations.

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
GLOW KLOW 70mg 80mg Factory direct sales lyophilized powder best quotation	Pharmaceutical Grade/99		Ningbo Shu You plastic Co., LTD	Inquiry
-LL37 Factory Direct Peptides Peptide Raw Material Manufacturer Bulk Peptide Supplier	Pharmaceutical Grade/99	$1/UNIT FOB	Jielu Trading	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry

Items	Specifications

99% LL37 , Raw, Peptide factory supplier

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches