Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS 1 Inquiries

Unit Price:

$1.98-2.28/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONG KONG

Brand:

Peptide

Packaging:

10mg/10 bottles per box

Price valid (until):

2026-07-25

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description

    


    Whatsapp:+85247161670

    Whatsapp:+8613180088146

    Maibox:Haha161670@outlook.com 

    telegram:@Lucy161670


    Shop liquid peptide bac water 10ML Warehouse in the United States   Semaglutide,Tirzepatide,Retatrutide,-Detailed Image 1


    Shop liquid peptide bac water 10ML Warehouse in the United States   Semaglutide,Tirzepatide,Retatrutide,-Detailed Image 2 Shop liquid peptide bac water 10ML Warehouse in the United States   Semaglutide,Tirzepatide,Retatrutide,-Detailed Image 3

    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.


    Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 2


    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .

    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .

    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root
    • causes for lasting impact .







    • Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 7


    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom
    peptides formulations, GLP-1 related peptides,  peptide for weight management, peptide supplements for metabolic health
    Customizable peptide, Skin care peptide, Beauty peptide , Muscle building peptide ,Hair growth peptide , Fitness peptide


    Shop Chinese warehouse - Fast delivery  Best Price Pancragen PA20-Detailed Image 6

    Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 9


    Physical and chemical properties:

    It has many excellent properties: high purity, light color, low viscosity, good processing properties, low volatility, low toxicity, low solidifying point, durable at room temperature and so on.




    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

    Shop Chinese warehouse - Fast delivery  Best Price Pancragen PA20-Detailed Image 8


    Hazard Identification

    Classification of the substance or mixture

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements


    Pictogram(s) Shop China Fast Delivery In Stock Methyl tetrahydrophthalic anhydride-Detailed Image 4
    Signal word

    Warning

    Hazard statement(s)

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.


    Other hazards which do not result in classification

           no data available


    Shop Chinese warehouse - Fast delivery  Best Price Pancragen PA20-Detailed Image 10


    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future


    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.


    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal


    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.


    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.


    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. 


    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

    Shop China Fast Delivery In Stock HCG AE XA G CN CP RT MS Different Peptides-Detailed Image 13


    Certificates
    • LL37 SS31 CH COR SM | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.