Product Description – The Science of LL-37 in Skin Research
LL-37 is a 37‑amino‑acid cationic peptide (sequence: [LL-37, 37 aa]) and the only known human cathelicidin — a class of host defense peptides that form a critical part of the innate immune system. In the skin, LL-37 is constitutively expressed in the epidermis and is dramatically upregulated in response to environmental challenges such as UV radiation, mechanical stress, and inflammatory signals. This unique human‑derived peptide has become a focus of advanced cosmetic research due to its multifaceted roles in skin renewal, barrier integrity, and cellular protection.
Keratinocyte Biology & Skin Renewal
Healthy skin appearance depends on the continuous renewal of the epidermal layer. LL-37 acts as a direct chemotactic agent for keratinocytes, the primary cell type of the epidermis, promoting their migration and supporting normal turnover. This activity operates through two well‑characterized pathways:
• FPR2 Activation – LL-37 binds to formyl peptide receptor 2 (FPR2) on keratinocytes, triggering signaling cascades that direct cell movement.
• EGFR Transactivation – The peptide also activates the epidermal growth factor receptor (EGFR), promoting cell cycle progression and cytoskeletal reorganization.
These mechanisms make LL-37 a valuable research ingredient for formulations intended to support skin resilience, barrier health, and natural repair processes.
Photoprotection & Antioxidant Properties
Environmental stressors, particularly ultraviolet radiation, accelerate skin aging by inducing oxidative stress and collagen breakdown. Recent peer‑reviewed research has demonstrated that LL-37 fragments possess anti‑inflammatory and antioxidant activities in human keratinocytes and dermal fibroblasts. The peptide has been shown to:
• Reduce intracellular reactive oxygen species (ROS) levels in UV‑exposed skin cells.
• Support collagen synthesis and inhibit glycation, helping to maintain dermal matrix integrity.
• Modulate melanin production, offering potential for skin brightening research.
These properties position LL-37 as a candidate for anti‑pollution, post‑sun recovery, and age‑defense formulations.
Inflammatory Balance & Skin Comfort
A balanced inflammatory environment is essential for even skin tone, reduced sensitivity, and overall comfort. LL-37 helps modulate cytokine responses, supporting a calm, resilient skin surface. This makes it particularly relevant for sensitive skin research, where maintaining homeostasis without irritation is a key goal. By promoting a healthy microbial environment and soothing reactive conditions, LL-37 can be explored in products for redness‑prone or easily irritated skin.
Scalp & Hair Research
Beyond facial skincare, LL-37 is also being studied for scalp applications. Its ability to support a balanced environment and promote healthy cell turnover makes it useful in serums and treatments targeting scalp comfort and hair follicle health. The peptide‘s light, water‑soluble nature allows it to be incorporated into leave‑on scalp formulas without leaving residue.
.
1. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.
Sales manager: Eira
whatsapp：+8619304441463
whatsapp：+852 9546 9358
Email: sales01@cnspks.com
1. Advanced Manufacturing Capabilities
Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
2. Innovation & Customer Commitment
Reliable Supply Chain: Competitive pricing & timely global delivery.
Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
Q1: May I get one sample before placing order?
Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.
Q2: Which payment is available for your company?
Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.
Q3: How and when can I get my goods after payment?
Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.
Q4: Is there any possible to use my appointed label or package?
Re: Yes. If needed, we'd lik.
1. Expertise in Peptide Synthesis
Extensive Experience: 7 Years of expertise in synthetic peptide development.
Skilled Team: Experts in solid-phase and liquid-phase synthesis.
2. Advanced Manufacturing Capabilities
Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
3. Innovation & Customer Commitment
Reliable Supply Chain: Competitive pricing & timely global delivery.
Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
4. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
5.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
6.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.
Why Choose Our Peptides?
- Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
- Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .
-
-
Why Partner with us?
Quality Assurance:
Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.
Flexible Supply:
Available in multiple formats. Consistent lead times with flexible production capacity.
Competitive Edge:
Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.
Technical Support:
Full documentation and formulation guidance.
Indonesia
