Product
Supplier
Encyclopedia
Inquiry
LL37 High purity buy - large image1
LL37 High purity buy - image1
LL37 High purity buy - image2
LL37 High purity buy - image3

LL37 High purity

1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

深圳

Packaging:

g

Price valid (until):

2026-07-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


     Whatsapp+85247317681

      Product Detail  

     


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 1


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 2
    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 3



     

      Packaging & Shipping  

     


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 4
    Europe 1-3days
    America 1-3days
    UK/Russia/Malaysia 1-3days
    North America 1-3days
    Air freight 1-3days
    Sea transport 1-3days
    Land transport 1-3days
    Packaging: vacuum packaging/aluminum foil packaging/fake packaging/sealed packaging
    Transportation: Sea/Air/land transportation. 
    Customs: 100% safe delivery, free re-delivery of any customs problems, guaranteed delivery


     

      Our Advantages

     


     Goods quality

    1. Product has COA, and HPLC report
    2. Our factory is ISO9001 standard
    3. We get good feedback from customers around the world

    OEM service
    1. Add customer's logo
    2. Redesign label, packing box as customer's requirement
    3. Cap color can be customized

    Shipping service
    1. Goods shipped in 2-7 days after get payment.
    2. Small order ship by express door to door.
    3. Goods arrive in 7-20 days

    24 hours on-time response
    1. Reply your inquiry within 12 hours
    2. Keep tracking goods and update information to custom er
    3. After-sale service anytime
    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 5


     

    Feedback from customers

     


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 6


    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 7

    Shop GMP Manufacture of Semaglutid Tirzepatid Retatrutide 5mg 10mg 20mg Vial Lyophilized Powder-Detailed Image 8


     

      FAQ  

     


    Q1: About the after-sale service of products
    A: After purchasing the products from our factory, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: Can I get some samples?
    A: Yes, we can provide samples, but the customer will pay the freight.

    Q3: How do I start paying?
    Payment can be made by Bitcoin,TT, L/C, DP  

    Q4: How to confirm product quality before placing an order?
    A: You can get free samples of some products. You just have to pay the shipping fee

    Q5: What is your MOQ?
    A: The minimum quantity we can order is 1kit.

    Q6: How to customize the product??
    A:You can send us your product specifications and requirements and we will produce products according to your requirements.




    Pls input...

    Items Specifications






    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

    Location:

    Room 314A, Block A, Tianjin Youth Entrepreneurship Park, No. 85 Qingnian Road, Hongqiao District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    20

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    101-200

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.