Contact Information:
WHATSAPP:+8615875350252
EMAIL:cting7458@gmail.com
please add my WhatsApp account to receive more product catalogs!
1. Company Introduction:
Our company specializes in exporting various chemical products, including chemical raw materials, a full range of peptide products.
We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.
Customers who have ordered our products（peptides）have had very good feedback.
World wide relaible buyers can contact us about the peptides.
2. Product Description:
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
3. Key Categories:
- Cosmetic Peptides: Acetyl Hexapeptide-8, Copper Peptide GHK-Cu, Pentapeptide-4, SNAP-8
- Pharmaceutical Peptides: Semaglutide, Tirzepatide, Thymosin Alpha-1, Epithalon
4. Specifications:
Purity: >98% (or refer to the Certificate of Analysis)
Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
Solubility: To be determined
Shelf Life: >2 years if stored properly
Drug Formulation: To be determined
Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).
HS Tariff Code: 2934.99.9001
5. Applications:
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
6. Why Choose Us:
Rich Industry Experience:
- We are a long-established leading professional manufacturer in China’s pharmaceutical industry. Our products are exported to Germany, Spain, the United Kingdom, the United States, Australia, the Middle East and numerous other regions worldwide. We have received consistent positive feedback from clients and built long-term, amicable cooperative partnerships.
-
- Superior Quality, High Purity & Competitive Pricing:
- Premium quality is the core of our competitive advantage. Sample orders are welcome, with a minimum order quantity (MOQ) of only 1 gram.
-
- Secure & Expedited Delivery:
We maintain sufficient in-house inventory, enabling same-day shipment upon receipt of payment.
We have dedicated logistics channels for shipments ranging from 0.01 kg to 3.5 kg per consignment. We also provide custom dissolving service to convert solid powder into liquid formulations, which will be packed in specialized sealed bottles for transportation.
-
- Comprehensive After-sales Support:
We will proactively update you with real-time shipping tracking information. Our team will make every effort to resolve any issues our customers may encounter.
Contact us for best quotation!
7. peptides have obvious advantages:
- Direct absorption without digestion
- Strong targeting and physiological activity
- Stable structure, easy to process and formulate
- High safety, good biocompatibility
These properties make peptides one of the most promising raw materials in the global health and beauty industry.
8.Main Functions & Benefits
Senescent Cell Clearance: Research suggests that senescent cells accumulate in the body with age and contribute to age-related decline and diseases. FOXO4-DRI is designed to selectively target and induce the death of these senescent cells while sparing healthy cells. By promoting the clearance of senescent cells, it aims to potentially mitigate age-related conditions.
Preclinical Studies: Studies conducted in animal models have shown promising results regarding the clearance of senescent cells and potential health benefits associated with reduced senescent cell burden. These studies have indicated improvements in various age-related conditions and tissue function.
Experimental Nature: Despite its potential benefits in preclinical studies, the use of FOXO4-DRI remains largely experimental. Comprehensive human studies regarding its safety, efficacy, and long-term effects are limited.
Safety and Efficacy in Humans: As of now, the safety profile and potential side effects of FOXO4-DRI in humans are not well-established due to the lack of comprehensive human trials. There's a need for further research to evaluate its safety, optimal dosage, and potential applications in human health.
FAQ:
Q1: About the after-sale service
A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future
Q2: How do I start paying?
Payment methods: USDT, Paypal Bitcoin, bank transfer, Alipay, and WeChat Pay.
Q3: How to confirm product quality before placing an order?
You can send us your product specifications and requirements and we can customize for you.
Q4: What is your MOQ?
A: The minimum quantity we can order is 1 box.
Q5: How is the quality I want to test.
A: Before production and extraction, we will test all raw materials.Quality is our top priority.All products are strictly tested and confirmed by our QC and QA, approved by Third Party Lab in China.So you will be assured with Good Quality if you choose us. We welcome you test the product and hope to get your feedback.
Q6 : Have you received my payment How long will it take
A: Generally, we can receive your payment the next day, and we will inform you as soon as we receive your payment.
After confirmation payment, we will send out package
Q7:When will you sent out the goods after successful payment
A: Normally the order will be delivery within 1-3 days after the order confirmed, except the customized products.
Q8:What modes of transportation do you have to choose
A: We cooperate with HKEMS, DHL, TNT, UPS, FEDEX, EMS, China Air Post ,sea transportation etc.
And with the SAFE SHIPPING in each country, you can receive the goods smoothly.It is fast and safe method.
Q9:How long does it take to the goods arrived
A: It is Depending on your location:
For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, HKEMS,Netherlands post.
For large order, please allow 5-8 days by Air, 20-35 days by Sea
At the same time, we have warehouses in Germany and California, and some orders can be sent directly from Germany or California.
Q10: How is the goods packed
A: We usually send goods with disguise package outside and a double-layer sterile transparent bag inside.We have tried thousand of package methods, it looks serious and discreet.
United States
United Kingdom
Cyprus
