Available FOXO4-DRI White Powder With Full COA Documents

Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

Function & Application

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

As an anti-aging peptide, FOXO4-DRI can induce apoptosis of senescent cells, thereby removing senescent cells from the body.

Mechanism of action: FOXO4 is upregulated in senescent cells and interacts with proteins such as p53, affecting the aging and apoptosis process of cells. FOXO4-DRI competitively binds to p53, blocking the interaction of FOXO4-p53, thereby inducing senescent cells to enter the apoptosis process.

we are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad.  We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.

    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.

    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

Why Choose Our Peptides?

• Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $90.75B by 2040.
• Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
• Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting
• 
• 
  
• 
  

• 
  

FAQ

Q1: About the after-sale service

A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

Q2: Do you have stock?

A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.

Q3: How do I start paying?

Payment can be made by Bitcoin,wire transfer or paypal

Q4: How to confirm product quality before placing an order?

A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

You can send us your product specifications and requirements and we can customize for you.

Q5: What is your MOQ?

A: The minimum quantity we can order is 1 box.

But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

Q6: Time for delivery?

A: Leading time within 3 business days,Shipping time about 8-10 business days. 

Q7: Why should I choose you?

A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.