Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping buy - large image1
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping buy - image1
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping buy - image2
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping buy - image3
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping buy - image4

Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Safe Fast Global Shipping

1 Inquiries

Unit Price:

$100-102/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Laboratory Grade

Content:

99%

Port:

SHENZHEN

Packaging:

10mg*10vials

Price valid (until):

2026-07-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide Products

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


     

      contact us  

    Name:Elowen

    Whatsapp:+852 6859 3103

    Email Address:elowen@boruimei.com

    Items Specifications
    Product Name:

    LL-37

       CAS: 154947-66-7
       Purity 99%
       Shelf life: 24 months
       Specification: 10mg*10vials/box
       Appearance:

    Lyophilized powder


    Product Features

    • High Purity:The purity is ≥99% (HPLC), single impurity ≤0.1%, complies with research quality standards, COA certificate available to guarantee stable and reliable quality.
    • Stable Performance: Adopts lyophilized powder form with great stability, easy storage and transportation, effectively retains original biological activity.
    • Clear Mechanism:A mitochondrial-targeted antioxidant peptide that protects mitochondria, extensively used in anti-aging, oxidative stress and mitochondrial function research.

    Shop high purity peptide Tirzepatide slimming peptide lyophilized powder CAS 2023788-19-2-Detailed Image 1

    Product Features

    • High Purity:The purity is ≥99% (HPLC), single impurity ≤0.1%, complies with research quality standards, COA certificate available to guarantee stable and reliable quality.
    • Stable Performance:Adopts lyophilized powder form with great stability, easy storage and transportation, effectively retains original biological activity.
    • Clear Mechanism:A mitochondrial-targeted antioxidant peptide that protects mitochondria, extensively used in anti-aging, oxidative stress and mitochondrial function research.


    • 1.High quality products with competitive pricing.
    • 2.Free samples available for your evaluation and testing.
    • 3.Fast, reliable delivery via reputable shipping lines.
    • 4.Trial orders are welcome for quality verification after sample approval.
    • 5.Proactive updates and full transparency at every stage of your order.
    • 6.Custom packaging solutions tailored to meet your specific requirements.

    Shop high purity peptide Tirzepatide slimming peptide lyophilized powder CAS 2023788-19-2-Detailed Image 2


     

      Our factory  

     


    Shop high purity peptide Tirzepatide slimming peptide lyophilized powder CAS 2023788-19-2-Detailed Image 3

    Shop high purity peptide Tirzepatide slimming peptide lyophilized powder CAS 2023788-19-2-Detailed Image 4


     

      How to order  

     


    Shop high purity peptide Tirzepatide slimming peptide lyophilized powder CAS 2023788-19-2-Detailed Image 5


     

      Delivery time  

     

    • USA: 7-12days (tax included)

    • Europe: 7–12 days (tax included)

    • Australia: 7–12 days (tax included)

    • Canada: 7–12 days (tax included)

    • Asia and Southeast Asia: 5–10 days (tax included)

    • Free redelivery is available if the parcel fails to arrive on time.

    FAQ

    1.Can we get your free samples?

    Yes, can. Our free sample can be provided for customers test. But the freight for express is obuyer's account.

    2.Can we do printing or label on the bottles?

    Yes, can. We can offer various printing ways,such, screen printing, hot stamping, label printing.

    3.What is the normal lead time?

    For stock products, within 24-48 hours after we receive your payment. For smaller customize color bottles, we will ship out within 3-5 days.

    4.What is your shipping terms?

    Faster ways: FEDEX, DHL, UPS, TNT, etc by sea or by air economy

    5.How does your factory do regarding quality control?

    We do test for 3 times before packing.


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide Products

    Location:

    No. 917, 9th Floor, Unit 1, Building 19, Shengshi Huayuan Business Center, Shunhua Road Sub-district, High-tech Zone, Jinan City, Shandong Province

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.