Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - large image1
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - image1
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - image2
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - image3
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - image4
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - image5
Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping buy - image6

Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping

1 Inquiries

Unit Price:

$35-45/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Industrial Grade

Content:

99%

Port:

China

Brand:

...

Packaging:

10mg*10vials

Price valid (until):

2026-08-10

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Semaglutide,Tirzepatide,Retatrutide,Pharmaceutical Peptide,Cosmetic peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.
    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.
    The importance of peptides:
    Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.


    COMPANY PROFILE  


    Lilly Peptides Limited (Hong Kong) company. was established in 2021. It is a dynamic technology enterprise with a strong R&D team composed of creative and motivated individuals. Our experienced R&D department utilizes scientific and research capabilities to provide new product designs, in order to better serve customers and promote our products. The company is committed to the research, production and global supply of high-quality peptide products. "Fast delivery and safe delivery" are our main advantages. Good feedback and repeat orders support the common development of our company and customers. "Quality first, customer first" is our consistently held principle. Additionally, we also provide door-to-door service, eliminating the inconvenience of going out to pick up the goods. We guarantee 100% safe transportation. There is also dedicated transportation, 100% safe delivery. In stock, orders are dispatched immediately, offering a time advantage. There is no need to worry about quality issues. We have qualification certificates.


    OUR SERVICES


    Items Specifications
    Before placing an order Please inform us of the types and quantities of the goods you need.
    Send the quotation We will send you a detailed quotation sheet including the total amount.
    after-sales service Available at any time  


      Product Details


    We firmly believe that this freeze-dried powder possesses unparalleled comprehensive advantages in terms of quality, performance and value. If you have any questions about this product or want to know how it can add value to your business, please feel free to contact us at any time. We are always committed to providing excellent customer service to help our clients achieve their business goals.
    Benefits:

    1 Ultra-low temperature freezing: Freeze the highly active components at -196 degrees, causing them to enter a dormant state.

    2. Effective regeneration: When using, add a solvent to the powder and mix it. After that, effective regeneration can be achieved, ensuring the high activity and high stability of the product.
    We offer a variety of peptide products. We can provide high-quality products and competitive prices for peptides.
    Customers who have ordered our products (peptides) have all given very positive feedback.


      Why did you choose us.


    We are a professional peptide supplier, offering four key advantages: high-purity products, efficient and safe global logistics, flexible and convenient payment methods, and a professional and dedicated team - all of which are designed to help your business reach a higher level.

    Shop Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping-Detailed Image 1 Shop Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping-Detailed Image 2

    We collaborate with numerous leading logistics companies worldwide. Our global transportation network guarantees that our safe and efficient logistics services can meet your urgent needs.

    Shop Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping-Detailed Image 3


      Frequently Asked Questions


    Question: What are the delivery time and transportation method?
    Answer: After receiving your payment, we will send the package to you via United States Postal Service, FedEx, DHL Parcel or other designated transportation methods. It will take approximately 10 to 15 working days to reach your address.
    Q: How should the peptide be stored after receiving it?
    A: The freeze-dried powdered peptide can be transported at room temperature in vacuum packaging, while the dissolved peptide needs to be refrigerated at 2℃ - 8℃. For long-term storage, the freeze-dried powdered peptide should be stored in a sealed container with desiccant and placed at -20℃ or -80℃, which can minimize the degradation of the peptide to the greatest extent.


      Product superiority


    Why choose us?
    1.All peptides and raw materials have a purity of over 99%, and we provide numerous HPLC test reports (anoshik).

    2. 100% Safe Delivery
    3. The lowest price across the entire network, unparalleled!

    4.payment method:USDT/BCT/Alipay

    Shop Trusted Supplier LL37 High-quality peptides, 99% purity, fast & secure global shipping-Detailed Image 4

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide,Tirzepatide,Retatrutide,Pharmaceutical Peptide,Cosmetic peptide

    Location:

    Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.