 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > (ll375)peptide

(ll375)peptide

TDS 1 Inquiries

Unit Price:

$20/MT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shenzhen

Brand:

Packaging:

10mg*10vial

Price valid (until):

2026-08-14

Contact Supplier

 Chat Now

Yiwu Zhanpian Trading Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

 Visit Store

Product Description
Seller Information
Inquiry History

Description

What is LL-37?

LL-37, formally known as human cathelicidin antimicrobial peptide, acts as a natural comprehensive defense factor inside the human body. Beyond being a core effector of innate immunity, it also works as an immune signaling messenger, inflammatory modulator and tissue repair promoter all in one.

It is the sole cathelicidin-type antimicrobial peptide synthesized by humans, quickly secreted by epithelial tissues and immune cells when infection or tissue damage occurs. Featuring a distinctive cationic amphipathic α-helix structure, the peptide precisely targets negatively charged pathogens such as bacteria, fungi and enveloped viruses, physically rupturing their outer membranes to eliminate them efficiently. Unlike conventional antibiotics that interfere with microbial metabolic pathways, its physical lysis mechanism rarely triggers bacterial drug resistance.

Its value is not limited to pathogen elimination. As a central immune regulator, LL-37 recruits immune cells including neutrophils via chemotactic effects, fine-tuning the whole inflammatory response to avoid overactive immune reactions that harm healthy tissue. Meanwhile, it kickstarts tissue regeneration: it accelerates epithelial cell migration, stimulates new blood vessel formation and optimizes extracellular matrix reconstruction to speed up wound recovery.

Boarding wide application prospects, LL-37 can be applied to research against drug-resistant microbial infections, the treatment of persistent hard-to-heal wounds, relief of inflammatory skin conditions like psoriasis, and barrier-repair skincare raw materials. Linking immune defense, inflammatory balance and tissue regeneration, this peptide is a highly promising research molecule across immunological study and clinical development.

What are its functions?

Core Biological Functions of LL-37 Peptide

Broad-spectrum Antimicrobial & Anti-biofilm Activity

LL-37 physically disrupts the cell membranes of Gram-positive bacteria, Gram-negative bacteria, fungi and enveloped viruses to eliminate pathogens. It dissolves bacterial biofilms that resist common antibiotics, with an extremely low risk of inducing microbial drug resistance.
Immune Regulation & Anti-inflammatory Effect

It acts as an immune signaling molecule to recruit neutrophils and other immune cells to infection sites. It neutralizes bacterial endotoxin and moderates inflammatory responses, preventing overactive inflammation from damaging normal tissues and relieving redness, swelling and irritation.
Accelerate Tissue & Wound Regeneration

LL-37 promotes the migration of keratinocytes and fibroblasts, stimulates angiogenesis and remodels extracellular matrix. It effectively speeds up the repair of damaged skin and mucosal wounds and reduces scar formation.
Repair Skin Barrier & Improve Inflammatory Skin Conditions

It restores impaired skin barriers, eases persistent inflammatory skin issues including dermatitis, rosacea and psoriasis, and alleviates repeated sensitive skin discomfort.
Auxiliary Anti-aging & Cytoprotection

It reduces chronic low-grade inflammation linked to aging, protects epithelial cells from oxidative damage, and maintains stable skin tissue health.

Shop (ll375)peptide-Detailed Image 1

Items	Specifications
Product Name	LL-37 / Human Cathelicidin Antimicrobial Peptide LL-37
CAS No.	154947-66-7
Specification	5mg per vial, custom dosage & packaging available
Molecular Weight	4493.3 Da
Purity	≥99% (by HPLC)
Appearance	White sterile lyophilized powder
Form	Sterile freeze-dried lyophilized powder
Storage Condition	Store at -20°C, sealed, protected from light and humidity; avoid repeated freeze-thaw cycles after reconstitution

Product Features 🏆

Quantitative HPLC testing verifies the purity of LL-37 peptide reaches above 98%.
Multiple batches of structural identification testing are conducted to guarantee stable molecular spatial conformation.
The whole synthesis workflow is finished within standardized dust-free biochemical clean workshops.
Intelligent automated production assembly line is equipped with real-time online quality monitoring system.
Every production batch is delivered with complete test archives, including COA, HPLC spectrum and mass spectrum reports.
Adopt sterile vacuum sealed vial packaging, matched with constant-temperature cold chain global shipping service.

Important Notice

All synthetic LL-37 peptide raw materials manufactured in our factory are solely intended for laboratory academic research. The product maintains consistent and stable quality, and we cooperate with university research institutes and biochemical labs across dozens of countries. Our professional technical consulting team and efficient sales group can promptly respond to all technical inquiries and order demands.

We enforce unified strict quality control standards, and adhere to sincere, transparent business principles, with stable product quality and thoughtful customer service as our core priorities. Supported by stable product indicators and flexible split-vial customization options, we sincerely invite laboratories worldwide to negotiate long-term stable cooperative partnerships for mutual growth.

We are a professional biotech manufacturer with years of focus on synthetic peptide R&D and mass synthesis. We integrate independent research synthesis workshops, automated production lines and cross-border sales departments into one integrated factory system.

All production and testing procedures comply with unified high-standard specifications, supported by a full sterile production environment, dedicated lyophilization equipment and independent vacuum split packaging processes. Our lyophilized LL-37 powder presents uniform white texture, outstanding solubility and long-lasting molecular bioactivity under specified storage conditions.

We accept small trial sample orders, large-volume bulk wholesale orders and customized split vial packaging. We provide one-stop solutions covering laboratory raw material procurement and private label customization needs.

Our Advantages

Self-owned LL-37 peptide R&D laboratory and closed dust-free sterile clean production workshop.
Independent quality inspection lab equipped with a full set of professional analytical testing instruments.
Diversified packaging specifications: 5mg/10mg sterile vials; bulk raw powder customization is supported.
Global professional constant-temperature cold chain logistics, protecting peptide molecular activity during long-distance transportation.
Sufficient ready stock, short delivery cycle and stable monthly production capacity.
Free professional technical parameter consulting service for immunology, antimicrobial and skin cell research projects.

Packaging Process

Crude LL-37 peptide purification & high-precision impurity interception filtration treatment
Low-temperature aseptic vacuum lyophilization cycle processing
Precise quantitative filling into medical-grade sterile glass vials
Secondary vacuum sealing and specification label pasting

Shipping and Payment Methods

Shop (ll375)peptide-Detailed Image 9

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
Retatrutide,Tirzepatide,Semaglutide,GHK-CU

Location:
Plot 1, No. 205 Tongbao Road, Jiangdong Subdistrict, Yiwu City, Jinhua City, Zhejiang Province

Payment Terms:
TT against B/L draft before shipment,100% TT in advance

Year of Establishment:
2026

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 high purity 99% freeze dried powder cas154947-66-7 senwayer hot sales	Pharmaceutical Grade/99	$85/MT FOB	Changsha Caoquan	Inquiry
LL37 Peptides White Powder CAS 154947-66-7 Secure Packaging Ready For Lab	Pharmaceutical Grade/99	$10/G FOB	Tranmoo	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry