Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - large image1
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - image1
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - image2
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - image3
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - image4
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - image5
Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments buy - image6

Separately Packed Sterile LL-37 Powder Merely Applied to Cell Culture Laboratory Experiments

1 Inquiries

Unit Price:

$40-45/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

mm

Packaging:

5mg/vial,10vials/box

Price valid (until):

2027-09-20

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Glutathione (GSH), also named Reduced Glutathione, is a tripeptide composed of glutamate, cysteine, and glycine. It can be found in almost every cell of human body. Nowadays, the industrial production of Glutathione is mainly obtained by enzymatic synthesis. In the method, Glutathione has a high purity and good water-solubility. As an active tripeptide with important physiological functions, Glutathione is the most important non-protein sulfhydryl compound in organisms. It has biological activities such as detoxification, anti-oxidation, free radical scavenging, skin-whitening and spot-fading. Therefore, it is widely used in cosmetics, medicine, health care products and other industries. It can be soluble in water greatly and easy to be added into all kinds of skin-whitening cosmetics.

    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 1
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 2
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 3
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 4
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 5

    Glutathione Key Functions

    Skin Whitening & Brightening:Inhibits melanin synthesis by reducing tyrosinase activity, fading dark spots and evening skin tone.Neutralizes free radicals that contribute to pigmentation disorders like melasma.

    Antioxidant Defense:Scavenges reactive oxygen species (ROS) from UV exposure and pollution, preventing collagen degradation and premature aging.Protects skin lipids and DNA from oxidative damage.

    Anti-Inflammatory Effects:Reduces redness and irritation caused by acne, eczema, or post-procedure inflammation.Calms skin sensitivity and itching.

    Hydration & Skin Barrier Support:Improves skin moisture retention by enhancing the stratum corneum’s lipid barrier.Promotes a smoother, plumper complexion.

    Hair Health:Combats oxidative stress in hair follicles, reducing breakage and graying.Supports scalp health and keratin production.

    Glutathione Mechanism of Action

    Direct Radical Scavenging:Glutathione’s thiol group directly neutralizes free radicals, breaking oxidative chain reactions.

    Indirect Antioxidant Support:Regenerates other antioxidants like vitamins C and E, amplifying their effects.

    Melanin Regulation:Inhibits tyrosinase, the enzyme critical for melanin production, without cytotoxicity.

    Cellular Detoxification:Binds to heavy metals and toxins, aiding their elimination from the skin.

    W hich type personal care products can be found Glutathione

    Whitening Serums & Creams: Targeted formulas for hyperpigmentation and uneven tone.

    Anti-Aging Products: Wrinkle-reducing creams and firming masks.

    Sensitive Skin Lines: Calming cleansers and post-procedure recovery gels.

    Sunscreens: Added to SPF products to boost UV protection and reduce photoaging.

    Anti-Graying Treatments: Scalp serums and hair masks to delay graying.

    Damage-Repair Formulas: Shampoos and conditioners for chemically treated or heat-damaged hair.

    Brightening Body Lotions: Targets dark elbows/knees and overall skin radiance.

    Detoxifying Bath Products: Cleanses and rejuvenates skin through antioxidants.

    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 6
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 7
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 8
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 9
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 10

    Product Name: Reduced Glutathione Powder
    CAS No.: 70-18-8
    Purity: ≥98%
    Appearance: White to off-white crystalline powder
    Grade: Cosmetic Grade
    Molecular Formula: C10H17N3O6S
    Molecular Weight: 307.32
    Storage Condition: Sealed and stored at 2-8°C, keep dry and away from light
    Shelf Life: 24 months

    Items Specifications
    Product Name  Reduced Glutathione Powder
    CAS No. 70-18-8
    Purity ≥98%
    Appearance White to off-white crystalline powder
    Grade Cosmetic Grade


      Product Advantages   


    Key Product Advantages
    1. Ultra-High Purity & Quality Assurance: Purity ≥99.0% verified by HPLC, with complete COA, HPLC, NMR, MS and other quality inspection reports provided, ensuring product quality meets international pharmaceutical raw material standards.
    2. Stable Production Process: Mature synthesis and lyophilization process, stable product properties, not easy to degrade, convenient for storage and long-distance transportation.
    3. Factory Direct Supply: Independent production base, sufficient inventory, fast and stable delivery, supporting small-batch trial orders and large-scale bulk wholesale.
    4. Flexible Customization: Support customized packaging specifications and personalized labeling services to meet diverse procurement needs of customers.
    5. Strict Quality Control: Full monitoring from raw material screening to finished product delivery, eliminating quality risks and ensuring product safety and reliability.

    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 11
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 12
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 13


      About us   


    Hong Kong Bosen Polypeptide R&D Co., Ltd. is a world-leading manufacturer and supplier of peptide products and pharmaceutical raw materials, specializing in the chemical industry.
    Our main products include peptide products and pharmaceutical raw materials. We possess strong R&D capabilities, exquisite synthesis technologies and advanced quality control methods. We actively carry out joint ventures and cooperation with major enterprises and manufacturers, and serve society and users adhering to the concept of industrial development. We always adhere to the orientation of market demand and continuously develop new high-tech chemical products and pharmaceutical intermediates.
    I am full of confidence in the quality of our products, and many overseas customers have given high praise after receiving the goods. Our products are of excellent quality, and we solemnly promise door-to-door delivery services worldwide. 4. We provide high-quality after-sales service aiming at customer satisfaction.



    FAQ  


    1. How to preserve peptides after receiving them?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder stored at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
     2. What is your lead time and shipping method?
    Customized items are negotiable. 1-3 working day after payment arranges the shipping. Parcels shipping by sea, by air, or by express (EMS, UPS, DHL, TNT, FEDEX, etc). 
    3. Is the shipping 100% Guarantee?
    Yes, we offer 100% Shipping Guarantee. If any seized parcel we will do resending. 
    4. What payment methods do you support?
     Wise/Bank wire/BTC/USTD/alibaba/Paypal
    5. Will I have any side effects after using peptide?
    If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.

    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 15
    Shop High Purity Glutathione Reduced Powder Cosmetic Raw Material-Detailed Image 16

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

    Location:

    RM 701, UNIT 108, 7/F, TWR B NEW MANDARIN PLAZA 14 SCIENCE MUSEUM RD TSIM SHA TSUI HONG KONG

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.