Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > TR| TongPeptides | 99% Purity |tirzepatide
TR| TongPeptides | 99% Purity |tirzepatide buy - large image1
TR| TongPeptides | 99% Purity |tirzepatide buy - image1
TR| TongPeptides | 99% Purity |tirzepatide buy - image2
TR| TongPeptides | 99% Purity |tirzepatide buy - image3
TR| TongPeptides | 99% Purity |tirzepatide buy - image4
TR| TongPeptides | 99% Purity |tirzepatide buy - image5
TR| TongPeptides | 99% Purity |tirzepatide buy - image6

TR| TongPeptides | 99% Purity |tirzepatide

TDS 3 Inquiries

Unit Price:

$4/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

china

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-14

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Descriptiopn


    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com

    Shop KPV5KPV10-Detailed Image 1 Shop KPV5KPV10-Detailed Image 2
    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com


    Tirzepatide is a novel long-acting synthetic peptide molecule widely explored in metabolic physiology and translational research. Structurally modified with fatty acid side chains, this 37-amino-acid peptide possesses high molecular stability and an extended half-life within biological systems, enabling sustained biological activity with prolonged action cycles. Distinct from conventional single-target metabolic regulators, it is characterized by its dual-receptor affinity, making it a unique research subject for studying intestinal hormone signaling and systemic metabolic balance.​

    The core biological feature of tirzepatide lies in its ability to simultaneously modulate two key intestinal hormone receptor pathways: GLP-1 and GIP. These two endogenous signaling systems play vital roles in coordinating human energy metabolism, nutrient processing, and physiological rhythm regulation. Through gentle and synergistic activation of dual pathways, tirzepatide assists in optimizing postprandial glucose metabolism, moderating energy intake signals, and stabilizing systemic metabolic fluctuations. This dual-regulation mechanism delivers more comprehensive physiological modulation effects compared with single-pathway analogs, drawing extensive attention in pre-clinical and clinical research.​

    In systematic experimental observations, tirzepatide shows favorable performance in improving metabolic homeostasis. It helps optimize gastric emptying rhythm, regulate cellular glucose uptake efficiency, and adjust overall energy turnover in the body. Long-term experimental data indicate that sustained intervention with this molecule contributes to improved metabolic indicators and balanced energy distribution, supporting stable physiological conditions in metabolic systems. Beyond basic glucose regulation, relevant studies also explore its potential correlations with vascular health and systemic metabolic optimization.​

    As a research-grade bioactive peptide, tirzepatide exhibits reliable molecular tolerance and predictable dose-response characteristics in standardized trials. Its unique structural design resists rapid enzymatic degradation in vivo, ensuring steady and continuous biological effects and reducing frequent administration demands. Such properties make it valuable for exploring long-term metabolic intervention strategies and chronic physiological balance regulation.​

    It is important to clarify that all applicable effects are observed under standardized experimental and medical supervision conditions. Individual physiological differences, dosage schemes, and lifestyle conditions will significantly influence practical outcomes. Current research continues to explore its deeper molecular mechanisms and potential application boundaries. As an innovative dual-pathway metabolic modulator, tirzepatide remains a key research focus in the field of metabolic biomedicine, offering new insights for the development of refined physiological regulation technologies.


      Shipping Method  Shop KPV5KPV10-Detailed Image 3 



    Shop KPV5KPV10-Detailed Image 4 Shop KPV5KPV10-Detailed Image 5 Shop KPV5KPV10-Detailed Image 6 Shop KPV5KPV10-Detailed Image 7
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11
    Shop KPV5KPV10-Detailed Image 9
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15
    Shop KPV5KPV10-Detailed Image 13 Shop KPV5KPV10-Detailed Image 14 Shop KPV5KPV10-Detailed Image 15 Shop KPV5KPV10-Detailed Image 16


    Introduction to Our Factory 


    We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.
    Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.
    Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.
    Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.
    We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use. Shop KPV5KPV10-Detailed Image 17


         Q&A    


    Q1: Why should you buy from us instead of other suppliers?

    A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q2: When can I receive the package?

    A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

    Q3: What is the minimum amount I can order?

    A3: The minimum quantity we can order is 1 box, which contains 10vials.Shop KPV5KPV10-Detailed Image 18 Shop KPV5KPV10-Detailed Image 19


    Items Specifications
    TR5mg10mg15mg

    mg*10vials

    20mg30mg40mg

    mg*10vials

    50mg60mg mg*10vials

    Shop KPV5KPV10-Detailed Image 20 Shop KPV5KPV10-Detailed Image 21 Shop KPV5KPV10-Detailed Image 22

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

    Research
    Class:

    Dual agonist — GIPR, GLP-1R

    Status:

    FDA-approved (Mounjaro / Zepbound)

    Mechanism:

    Dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. A 39-amino-acid modified peptide with a C20 fatty diacid moiety that enables albumin binding for extended half-life (~5 days). Selectively activates both GIPR and GLP-1R signaling pathways.

    EC50 (Human GLP1R):

    0.934 nM

    EC50 (Human GIPR):

    0.0224 nM

    Source:

    Frias JP, et al. N Engl J Med. 2021;385(6):503-515.DOI

    FDA:

    Mounjaro, Zepbound (approved 2022-05-13)

    References
    ChEMBL:

    CHEMBL4297839

    DrugBank:

    DB15171

    KEGG DRUG:

    D11360

    PubChem:

    PubChem

    Disclaimer:

    Tirzepatide is approved as a prescription medicine (Mounjaro, Zepbound) in certain jurisdictions. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.