Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - large image1
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - image1
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - image2
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - image3
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - image4
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - image5
2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping buy - image6

2024 hotest product facturey LL-37, human antimicrobial peptide manufacturer faster shipping

Unit Price:

$204.39-252.71/KG FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Tianjin

Brand:

NINGBO HENGHUA TECHNOLOGY

Packaging:

Bag, Carton, Drum

Price valid (until):

2029-11-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

S3,14 bd0

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Items Specifications
    Assay ≥99%
    Appearance White crystalline powder
    Capacity 200mt/year

    Storage conditions :

    The goods should be sealed and light-proof, and stored in a dry, cool and well-ventilated place. Storage conditions for special products are treated differently.

    Is it spot: Our products are spot

    When to ship: The payment is received before 3 o'clock on the same day or the next day, and the payment is received on the second or third day after 3 o'clock.

    Logistics issues:

    Samples are transported by express delivery, and large goods are transported by logistics and sea transportation.

    Is the quality guaranteed: Our company generally signs a purchase and sales contract when purchasing goods, and provides product test reports with the goods. If the customer has requirements for the product, the customer will first check the product indicators.

    About product packaging:

    The general standard packaging is 25KG cardboard barrel packaging. If you have special requirements for the product, you can contact us.\

    Shop 2024 Hot Sale 1,4-butanediol Important organic and fine chemical raw materials-Detailed Image 1 Shop 2024 Hot Sale 1,4-butanediol Important organic and fine chemical raw materials-Detailed Image 2 Shop 2024 Hot Sale 1,4-butanediol Important organic and fine chemical raw materials-Detailed Image 3 Shop 2024 Hot Sale 1,4-butanediol Important organic and fine chemical raw materials-Detailed Image 4 Shop 2024 Hot Sale 1,4-butanediol Important organic and fine chemical raw materials-Detailed Image 5 Shop 2024 Hot Sale 1,4-butanediol Important organic and fine chemical raw materials-Detailed Image 6



    NINGBO HENGHUA TECHNOLOGY DEVELOPMENT CO.,LTD

    NINGBO HENGHUA TECHNOLOGY DEVELOPMENT CO., LTD. Is A PROFESSIONAL ENTERPRISE ENGAGED IN EXPORT, 

    the products mainly include chemical products, medical devices, masks, machinery, chemical RAW materials, pharmaceutical INTERMEDIates. 

    We have more and more customers from all over the world. We can provide our customers with the best product quality and reasonable price.

    Our aim is "service and sincere exchange for your trust and support, mutual benefit and win-win". We look forward to working with friends all over the world!

    In order to meet the requirements of importers and middlemen, further provide customers with "door to door" service. 

    We have our own export service system, can provide customers with the best export route and the lowest price.
    We have a skilled, operational ability of the team. 

    In addition, we can find the goods with the lowest price and the best quality for overseas customers, 

    check the goods and reserve shipping space, so as to open up the Chinese market and relieve the import and export



    FAQ

    What are our service and advantages ?
    We can supply high quality products and first-class service for our clients.

    Now, we can offer best service for our clients. And more advantages as below.

    1. We can supply sample for testing

    2. We work with DHL, FedEx, TNT, UPS, HKEMS established long-term stable cooperative relationship! If the parcel was loss,we will reship for free

    3.Payment: TT,PayPal,West Union,USDT,BTC,30-90 days BL

    4. If you want new products,we can synthesis it for your and secret.

    5. Higher purity with lower price and first -class service

    6. Manufacturer: total output more than 10% of the Nationwide, market share more than 15%

    7. High quality: The world''s top production equipment, high precision of the manufacturing process

    8. Low price:The most advanced production equipment and the most cheap raw materials

    9. Safe transport channel:We have a professional transport team to ensure the goods safety and on time arrived your hand.

    10.10 years quality guarantee:Ten years gold medal quality assurance,perfect after-sales service and first-class technical team,Let you easy shopping.


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    S3,14 bd0

    Location:

    Room8-18,building156,No.19,26,27,QinglinCommercial Plaza,Haishu District,Ningbo City,Zhejiang Province

    Payment Terms:

    TT against copy of documents,L/C,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2020

    Ningbo Henghua Technology Development Co., Ltd. is a company specialized in export. Our main products include pharmaceutical intermediates, food additives, chemical products, and cosmetic raw materials. These products are exported to over 80 countries and regions, including North America, Europe, Singapore, Australia, Russia, Africa, the Middle East, and more. Additionally, we offer product customization services to meet the specific needs of our clients. With a global customer base, we are able to provide the best product quality at competitive prices.

    To further meet customer demands and offer "door-to-door" services, we have established our own export service system. This allows us to provide clients with optimal export routes at the lowest possible prices.

    Moreover, we have a top-tier R&D team, a professional production team, and a strict quality control department, enabling us to offer overseas clients the best goods at the lowest prices, inspect products, and reserve shipping spaces, thus facilitating the expansion of the Chinese market and eliminating concerns regarding import and export. We also provide patient and attentive after-sales service to assist with any issues during the order process.

    By choosing henghua, you will have a reliable partner, high-quality products, fast and secure transportation, and worry-free after-sales support. Our mission is to "earn your trust and support through service and sincerity, achieving mutual benefit and win-win outcomes." We adhere to the management principles of "Quality First, Service First, Continuous Improvement, and Innovation to Satisfy Customers," with a quality goal of "Zero Defects, Zero Complaints." Henghua Technology looks forward to cooperating with friends from all over the world!

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.