Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Hign purity 99.9% high quality Lipo C white raw powder
Hign purity  99.9% high quality Lipo C  white raw powder buy - large image1
Hign purity  99.9% high quality Lipo C  white raw powder buy - image1
Hign purity  99.9% high quality Lipo C  white raw powder buy - image2
Hign purity  99.9% high quality Lipo C  white raw powder buy - image3
Hign purity  99.9% high quality Lipo C  white raw powder buy - image4
Hign purity  99.9% high quality Lipo C  white raw powder buy - image5
Hign purity  99.9% high quality Lipo C  white raw powder buy - image6

Hign purity 99.9% high quality Lipo C white raw powder

TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangdong

Brand:

CaoQuan

Packaging:

5mg/vial; 10vials/box

Price valid (until):

2025-09-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager:Claire
    whatsapp:+8618330919622
    Email:18330919622@163.com



      Product Detail  


    Description

     

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


     
    Items Specifications
    Appearance White or of- white powder or crystlline power,odorless
    Solubility Very soluble in N,N-Dimethylformamide,Soluble in methanol,Sparingly soluble inglacial acetic acid, Very slightly soluble inchloroform, Practically insoluble in water.
    Melting Point 152°C~156°C

    • Shop Hign purity  99.9% high quality Lipo C  white raw powder-Detailed Image 1


      Shop Nutrition Suppplement Vitamin B12 Powder Hot Sale Vitamin  Food Additives Pharmaceutical Grade Raw Powder-Detailed Image 1 Shop Nutrition Suppplement Vitamin B12 Powder Hot Sale Vitamin  Food Additives Pharmaceutical Grade Raw Powder-Detailed Image 2


    Shop TB500 peptide raw powder material in Stock Peptide-Detailed Image 2


    Shop Nutrition Suppplement Vitamin B12 Powder Hot Sale Vitamin  Food Additives Pharmaceutical Grade Raw Powder-Detailed Image 4


    FAQ:

    Q1: Are you trading company or manufacturer?A1: We are chemical manufacturerin China. So we can provide wholesale price.
    Q2: Why is the quoted price different from the listed price?
    A2: As we all know, the price of chemicals is not fixed, butfluctuates with the market.
    Q3: Has the quality of your products passed the test of a third-party authoritative testing agency?
    A3: Yes, all products are strictly tested by our quality control before shipment, and the quality assurance is confirmed and
    approved by third-party laboratories in China, the United States, Canada, Germany, the United Kingdom, Italy, France and other
    countries. If you choose us, we will guarantee to provide you with the highest quality products and services.
    Q4: If the inspection result can not meet the agreement between the two sides, can you bear all the losses caused by this?
    A4: Yes, we can. We guarantee that the samples provided will meet the needs of our clients and we will bear the risk of default.
    Q5: How can I get samples, how much is the MOQ, and how can I confirm the product quality?
    A5: We can offer you free samples of our existing products, the delivery time is about 1-3 days, you only need to pay the sample
    shipping cost. Our MOQ starts from 1g-1000g. Confirm the product quality You can send us your product specifications and parameter
    requirements, we will manufacture the product according to your parameter requirements or provide according to the sample quality
    parameters.
    Q6: What are your payment terms?
    A6: We can accept various payment methods,  T/T, T/T, BTC (Bitcoin), etc.
    Q7: Are there any discounts?
    A7: Yes, for bulk purchase orders, we always support with better price.
    Q8: How about the delivery time?
    A8: The delivery time is about 7-20 days after confirming the payment. Delivery times vary from country to country. (excluding
    Chinese holidays)

    For payment: We can accept Bitcoin,Paypal, bank TT to company, bank TT to private account



      Company Profile 


    CaoQuan Technology Co., Ltd., located in ChangSha City, HuNan Province, is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.

    As a leading peptide manufacturer,CaoQuan  Technology has a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.

    In terms of production technology,CaoQuan  Technology adopts internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide.Shop TB500 peptide raw powder material in Stock Peptide-Detailed Image 6 Shop TB500 peptide raw powder material in Stock Peptide-Detailed Image 7


    Why Choose US   


    • High Purity (≥98%) – Strictly tested, consistent quality.


    •  Flexible Packaging Options – 10mg/vial, bulk available.


    • Trusted by Global Buyers – Stable supply, fast delivery.

    packaging and shipping

    Suitable packaging:
    The packing suits you best would be choosen to cross customs safely. Or if you have your own ideal way, it could be also taken in consideration

    Secure shipping:
    Shipping by professional forwarder Security EMS/DHL/TNT /FedEx/UPS, Aus Post, Royal Mail express,etc. Door to door service.

    Competitive prices:
    A discount would be given when you make a large order. VIP price for next orders.



    Our Certificate


    Shop Hign purity  99.9% high quality Lipo C  white raw powder-Detailed Image 8

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

    Location:

    Room 102, No. 60-20, Gongnong Street, Xiangya Road Subdistrict, Kaifu District, Changsha City, Hunan Province, China

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.