Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 Quality Wholesale Price 99% purity
LL37 Quality Wholesale Price 99% purity buy - large image1
LL37 Quality Wholesale Price 99% purity buy - image1
LL37 Quality Wholesale Price 99% purity buy - image2
LL37 Quality Wholesale Price 99% purity buy - image3
LL37 Quality Wholesale Price 99% purity buy - image4
LL37 Quality Wholesale Price 99% purity buy - image5
LL37 Quality Wholesale Price 99% purity buy - image6

LL37 Quality Wholesale Price 99% purity

TDS

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2026-04-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description

    Appearance: Powder

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Appearance: Powder


      Product Detail  


    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 1

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 2


    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 3

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 4

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 5



    Items Specifications
    Appearance

     Powder

    MOQ

    10vials

    Purity

     >99% 

    Storage Condition

    Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years)

    Solubility

    To be determined

    Shelf Life

    >2 years if stored properly



     

      Peptide Storage Guidelines: General Tips  

     


    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 6

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 7

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term

    Why choose us

     


    Our Advantages:

    1.High quality with competitive price.

    2. All purity>99%.

    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery.

    1. Parcel can be sent out in 24 hours after payment tracking number available.

    2. Secure and discreet shipment verious transportation methods for your choice.

    3. Customs pass rate >99%.

    We have clients throughout the world.

    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 8

    Quality : Above 99% Purity, manufacturer direct supply the products

    Tranport : Over 99% customs clearance can be guaranteed, the delivery time within 1 week and arrival time is 1-2 weeks, Even if the goods are detained, i will resend the goods.

    Price :   We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect. 

    You get what you pay off, if you have any questions, i will have the answer.


    Shipping&Advantage 


    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 9

    Shop LL37 Quality Wholesale Price 99% purity-Detailed Image 10



       



    FAQ  


    Q1: Are you a manutacturer or trading company?
           We are manufacturer,welcome to visit us.
    Q2: How to confirm the product quality before placing the order?
           Sample could be provided , and we have the inspection report issued by an authoritativethird-party testing agency.
    Q3: What's your MOQ?
           It depends on different products , we can accept sample order or provide sample for your test.
    Q4: How about delivery time / method?
           We usually ship within 1-3 working days after your payment We can ship by door to door courier, air , sea , you also can choose your forwarder shipping agent.
    Q5: Do you provide after sales service?
           provide 24* 7 service . We can talk by email , skype , whatsapp , phone or whatever youfeel convenien.
    Q6: How to solve the after-sale disputes?
           We accept Changing or Refunding service if any quality problem.


    Certificates
    • LL37 Quality Wholesale Price 99% purity Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.