Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 good price 99% Purity Powder High Quality Fast Delivery
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - large image1
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - image1
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - image2
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - image3
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - image4
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - image5
LL37  good price 99% Purity Powder High Quality Fast Delivery buy - image6

LL37 good price 99% Purity Powder High Quality Fast Delivery

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2026-09-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description
    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 1 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 2 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 3 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 4 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 5

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirement

    Items Specifications
    Purity

    99%

    Appearance

     powder

    Storage

    Dry and Cool Place, Frozen

    Package and Delivery

     


    Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 6

     

    Shipping Method   

     


    Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 7

     

    Q&A   

     


    Q1: Why should you buy from us instead of other suppliers?

    A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q2: When can I receive the package?

    A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 15 days.

    Q3: What is the minimum amount I can order?

    A3: The minimum quantity we can order is 1 box, which contains 10 vials.

     

      Payment method 

     


    Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 8

    our advantage 

     


    1. High quality standards: All ingredients are tested for purity and performance.

    2. Competitive prices: We offer exceptional value without compromising quality.

    3. Customization: Solutions tailored to your specific needs and formulations.

    4. Reliable delivery: Timely and efficient transportation to ensure that your production schedule is met.

    Company Profile  


    The company utilizes internationally advanced equipment and technologies, strictly adhering to relevant national standards and regulations at every stage of the product lifecycle, from raw material screening and processing to finished product packaging, to ensure product quality and safety. Furthermore, the company has established a comprehensive quality management system and after-sales service network, providing customers with comprehensive, one-stop support.

    Adhering to the corporate philosophy of "Technology Leads Health, Quality Shapes the Future," the company prioritizes people and pursues a path of technological innovation. While prioritizing product quality and innovation, the company actively fulfills its social responsibility and is committed to promoting the development and progress of the health industry.
    Looking forward, the company will continue to deepen its research and development of peptide products, continuously exploring breakthroughs, and strive to become a global leader in the peptide industry, making significant contributions to human health.

    Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 9 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 10 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 11 Shop LL37  good price 99% Purity Powder High Quality Fast Delivery-Detailed Image 12

    Certificates
    • LL37  good price 99% Purity Powder High Quality Fast Delivery Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.