Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - large image1
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - image1
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - image2
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - image3
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - image4
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - image5
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size buy - image6

Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size

TDS

Unit Price:

$60/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

Shanghai

Brand:

DX

Packaging:

10vials/box

Price valid (until):

2027-12-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,trizepatide,Semaglutide,Retatrutide

  • Product Description

  • Seller Information

  • Description

    Sales manager:Ella
    whatsapp:+8618233925855
    Email:ella@xtdaxiang.cn

    Sincerely Look Forward To Your Inquiries About Our Products.



    Description:

    • Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

      The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

      we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

      This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!

    • Application:

      1. LL37 has been used as an antimicrobial agent to improve wound healing.

      2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

      3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

      4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

      5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

      6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.


    Items Specifications
    CAS number 154947-66-7
    Product Name

    LL37

    Purity 99%
    Molecular Formula C121H200N42O39
    Appearance  White powder
    Grade Pharmacy Grade
    Packaging 5mg/vial, 10vials/box 
    MOQ 10vials



    Shop High Quality Oxytocin Acetate High purity low price Peptide Oxytocin Acetate Oxytocin Acetate 6233-83-6-Detailed Image 2

    Shop High Quality Oxytocin Acetate High purity low price Peptide Oxytocin Acetate Oxytocin Acetate 6233-83-6-Detailed Image 4

    Shop High Quality Oxytocin Acetate High purity low price Peptide Oxytocin Acetate Oxytocin Acetate 6233-83-6-Detailed Image 6

    Shop High Qulity Melatonine CAS 73-31-4   10mg Vials for Sleep Disorders ,Whitening and brightening spots-Detailed Image 6



      Peptide Storage Guidelines: General Tips


    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide  Fitness and Weight Loss-Detailed Image 6


      Company Profile


    Shop High Performance Glutathione Reduced CAS 70-18-8 for Skin Care Glutathione 1500mg-Detailed Image 6

    Daxiang Technology Co., Ltd., is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.​

    As a leading peptide manufacturer, Daxiang Technology has a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.​

    In terms of production technology, Daxiang Technology adopts internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.​

    Daxiang Technology adheres to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.​

    In the future,Daxiang Technology Co., Ltd. will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.

    Shop High Performance Glutathione Reduced CAS 70-18-8 for Skin Care Glutathione 1500mg-Detailed Image 7
    Shop High Performance Glutathione Reduced CAS 70-18-8 for Skin Care Glutathione 1500mg-Detailed Image 8

    Shop High Performance Glutathione Reduced CAS 70-18-8 for Skin Care Glutathione 1500mg-Detailed Image 9


    Why choose us?   


    We have clients throughout the world.
    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.
    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    Our Advantages.

    1.High quality with competitive price.
    2. All purity>99%.
    3. We are manufacturer and can provide high quality products with factory price.
    Fast and safe delivery.
    1. Parcel can be sent out in 24 hours after payment tracking number available.
    2. Secure and discreet shipment verious transportation methods for your choice.
    3. Customs pass rate >99%. Shop High Quality DSIP 5mg 10mg Delta-Sleep Inducing Peptide Dsip CAS 62568-57-4 Emideltide-Detailed Image 13


       

    Payment  Modes


    Shop High Performance Glutathione Reduced CAS 70-18-8 for Skin Care Glutathione 1500mg-Detailed Image 11


      Product transportation


    Shop High Performance Glutathione Reduced CAS 70-18-8 for Skin Care Glutathione 1500mg-Detailed Image 12


    FAQ   


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Certificates
    • Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 5mg Size Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,trizepatide,Semaglutide,Retatrutide

    Location:

    Room 2012, No. 6-143, Section 2, Shanghai Road, Guta District, Jinzhou City, Liaoning Province

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

     Daxiang Technology Co., Ltd. is a leading manufacturer and global supplier of high-quality peptide-based pharmaceuticals and fine chemicals. We specialize in the research, development, and production of diverse peptide compounds that meet the rigorous standards of the international pharmaceutical and biotechnology industries.
    Our commitment to excellence is reflected in our strictly GMP-compliant manufacturing facilities, ensuring the highest levels of quality, purity, and consistency in every product.
    We always adhere to market demand as our guide, and continually develop and synthesize new high-tech chemical products.
    Leveraging our global footprint, our products are exported to Europe, the Americas, Southeast Asia, Africa, and other regions, serving customers worldwide.
    Driven by innovation and a customer-centric philosophy, Daxiang Technology Co., Ltd. is dedicated to being your trusted partner for premium peptide solutions, supporting advancements in healthcare and technology worldwide.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.