Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 Fast Delivery good price 99% Purity Powder Hot Sales
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - large image1
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - image1
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - image2
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - image3
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - image4
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - image5
LL37 Fast Delivery good price 99% Purity Powder Hot Sales buy - image6

LL37 Fast Delivery good price 99% Purity Powder Hot Sales

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2026-12-03

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description



    Company Introduction


    Tianjin Apex Import and Export Trading Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.
    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly. Our customers come from countries including the United States, Europe,
    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment. Please let us know the specific quantity you need, and we will offer you the most competitive price. Feel free to contact us for more information.







    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 1














    Items Specifications
    Purity 99%
    Appearance powder
    Storage Store at -20°C
    Delivery Time
    3-5days


    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 2 Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 3


    We offer various types of peptides,are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.about the peptides,we can provide the good quality,the good price.Customers who have ordered our products(peptides)have had very good feedback.
    World wide relaible buyers can contact us about the peptides.

    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 4 Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 5




      

    Storage conditions :

    The goods should be sealed and light-proof, and stored in a dry, cool and well-ventilated place. Storage conditions for special products are treated differently.

    Is it spot: Our products are spot

    When to ship: The payment is received before 3 o'clock on the same day or the next day, and the payment is received on the second or third day after 3 o'clock.

    Logistics issues:

    Samples are transported by express delivery, and large goods are transported by logistics and sea transportation.

    Is the quality guaranteed: Our company generally signs a purchase and sales contract when purchasing goods, and provides product test reports with the goods. If the customer has requirements for the product, the customer will first check the product indicators.

    About product packaging:

    The general standard packaging is 25KG cardboard barrel packaging. If you have special requirements for the product, you can contact us.

    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 6

    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 7




    Our Advantages:

    1.High quality with competitive price.

    2. All purity>99%.

    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery.

    1. Parcel can be sent out in 24 hours after payment tracking number available.

    2. Secure and discreet shipment verious transportation methods for your choice.

    3. Customs pass rate >99%.

    We have clients throughout the world.

    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 8

    transportation

    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 9


    Payment Methods
    Shop LL37 Fast Delivery good price 99% Purity Powder Hot Sales-Detailed Image 10


    FAQ


    Q1:Are you a supplier or a manufacturer?
    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?
    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?
    A:, Bitcoin, PayPal.USDT.

    Q4:How is the after-sales service?
    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?
    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

    Q6: How to confirm the Product Quality before placing orders?
    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    Q7:Is there any discount?
    A:Yes, for larger quantity, we always support with better price.

    Certificates
    • LL37 Fast Delivery good price 99% Purity Powder Hot Sales Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.