Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - large image1
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image1
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image2
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image3
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image4
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image5
Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid buy - image6

Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid

TDS 1 Inquiries

Unit Price:

$60-70/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHENZHEN

Brand:

JNZWXS

Packaging:

1g/unit 1mg-10mg

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Description

    Sales Manager:Jane

    Email: zwxs3@zwxstech.com

    Whatsapp: +86 15634077884


      Product Detail  


    LL37, also known as antimicrobial peptide LL-37, is a 37-amino acid at the N-terminal of Cathelicidin protein, named for its original amino acid L-L, and is the only antimicrobial peptide found in humans derived from Cathelicidin.


    Product Description


    1. LL 37 peptide, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide.LL 37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. CAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes

      Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable. 

    Items Specifications
    Product name LL 37
    CAS No. 67727-97-3
    Purity 99%
    Appearance White powder
    Function Weight loss



    Epithalon

      Shop KPV  Peptide Vials Raw Materials α-MSH (11-13) (free acid) Peptide Wholesale China Raw Powder 5mg 10mg 15mg vials yalin-Detailed Image 1 Shop KPV  Peptide Vials Raw Materials α-MSH (11-13) (free acid) Peptide Wholesale China Raw Powder 5mg 10mg 15mg vials yalin-Detailed Image 2 Shop KPV  Peptide Vials Raw Materials α-MSH (11-13) (free acid) Peptide Wholesale China Raw Powder 5mg 10mg 15mg vials yalin-Detailed Image 3 Shop KPV  Peptide Vials Raw Materials α-MSH (11-13) (free acid) Peptide Wholesale China Raw Powder 5mg 10mg 15mg vials yalin-Detailed Image 4 Shop KPV  Peptide Vials Raw Materials α-MSH (11-13) (free acid) Peptide Wholesale China Raw Powder 5mg 10mg 15mg vials yalin-Detailed Image 5 Shop KPV  Peptide Vials Raw Materials α-MSH (11-13) (free acid) Peptide Wholesale China Raw Powder 5mg 10mg 15mg vials yalin-Detailed Image 6


    Company Prolle


    We have many years of trading experience and are professional   Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

    Shop High-purity Semaglutide CAS 910463-68-2 freeze-dried powder peptide-based drug weight control wholesale price-Detailed Image 6 Shop High-purity Semaglutide CAS 910463-68-2 freeze-dried powder peptide-based drug weight control wholesale price-Detailed Image 7 Shop High-purity Semaglutide CAS 910463-68-2 freeze-dried powder peptide-based drug weight control wholesale price-Detailed Image 8 Shop High-purity Semaglutide CAS 910463-68-2 freeze-dried powder peptide-based drug weight control wholesale price-Detailed Image 9


      Saipping a Dallvary  


    Shop High-purity Semaglutide CAS 910463-68-2 freeze-dried powder peptide-based drug weight control wholesale price-Detailed Image 10 Shop High-purity Semaglutide CAS 910463-68-2 freeze-dried powder peptide-based drug weight control wholesale price-Detailed Image 11


      Our Advantage  


    1.GMP factory guarantee good quality.

    2.Offer factory competitive prices.

    3.Rich experience for safe and fast shipping.

    4.Twenty-four hours on-time service.


      FAQ  


    Q1: About the after-sale service of products
    A: After purchasing the products from our factory, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: Can I get some samples?
    A: Yes, we can provide samples, but the customer will pay the freight.

    Q3: How do I start paying?
    Payment can be made by Bitcoin,wire transfer or paypal

    Q4: How to confirm product quality before placing an order?
    A: You can get free samples of some products. You just have to pay the shipping fee or arrange for the sample to be sent to us by express.
    You can send us your product specifications and requirements and we will produce products according to your requirements.

    Q5: What is your MOQ?
    A: The minimum quantity we can order is 1kg.
    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

    Q6: Shipping Time?
    A: We ship the parcel out in 3-7 days and offer tracking No.. Shipping time is different to different country. Please consult.

    Certificates
    • Large Quantity in Stock Peptides Ll37 High Quality and Best Price Global Safe Delivery 99% Purity Customized Peptid Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 41-9, Fenghuangshan Road, Beiyuan Street, Tianqiao District, Jinan City, Shandong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.