Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - large image1
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - image1
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - image2
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - image3
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - image4
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - image5
NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality buy - image6

NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

100milligrams /500 milligrams /1000milligrams. 10 bottles per box

Price valid (until):

2027-03-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail     ——

    Main Specifications / Special Features: Product Description

    We firmly believe that this freeze-dried powder boasts unparalleled comprehensive advantages in terms of quality, performance and value. If you have any questions about this product or want to know how it can add value to your business, please feel free to contact us at any time. We are always committed to providing excellent customer service to help our clients achieve their business goals.

    Benefits:

    1. Ultra-low temperature freezing: The highly active components are frozen at -196 degrees, causing them to enter a dormant state.

    2. Effective regeneration: When using, add a solvent to the powder, and after mixing, it can be effectively regenerated, ensuring the high activity and high stability of the product.

    We offer various types of peptides. We can provide high-quality products and competitive peptide prices.

    Customers who ordered our products (peptides) have given very positive feedback.

    Reliable buyers from all over the world can contact us for inquiries about peptides.

    We believe that the Golden Cup offers an unparalleled combination of quality, performance and value. If you have any questions about this product or would like to know more about how it can benefit your business, please feel free to contact us.

    Detailed pictures

    We offer professional packaging services

    Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 1

    ——      FAQ     ——

    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd like

    Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 2

    ——      Why Choose Us      ——

    We have clients throughout the world.
    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.
    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 3

    ——      Our advantage    ——

    At the core of our operations is the unwavering commitment to our guiding principles : "Quality First, Service Supreme."Our mission is to spearhead advancements in biotechnology by consistently upholding the highest standards of quality and service. Through innovation and excellence, we aim to contribute to the betterment of global health and well-being.

    Our primary focus encompasses a range of products , including weight loss peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Tirzepatide, Retatrutide, and others.Provides reliable and timely custom manufacturing services for API following stringent quality system and close communication with the Clients.We have professional sales team , focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market, our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.

    With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers .

    Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 4 Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 5 Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 6 Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 7 Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 8

    ——       Our factory      ——

    We are a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.
    As a leading peptide manufacturer,We have a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.
    In terms of production technology, We adopt internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.
    Our company adhere to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.
    In the future,We will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.

    Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 9 Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 10

    ——      Packing & Delivery     ——Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 11

    Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 12 Shop NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality-Detailed Image 13


    Welcome to be our distinguished customer,please do not hesitate to contact us!

    Certificates
    • NAD+ NJ100 NJ500 NJ1000 CAS154947-66-7 Provided by the factory High Quality Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.