Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - large image1
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - image1
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - image2
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - image3
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - image4
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - image5
99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only buy - image6

99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

HNYH

Packaging:

5mg/vial,10vial/box

Price valid (until):

2026-06-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only

    LL37 is the only cathelicidin-derived antimicrobial peptide found in humans. LL37 is derived from the C-terminal region of the hCAP-18 protein (human cationic antimicrobial protein 18). The peptide adopts an alpha-helical structure in physiological solutions and is known for its amphipathic properties, which allow it to interact with lipid membranes. LL37 is classified as a research-grade host defense peptide.

    LL37 is supplied as a white to off-white lyophilized powder with ≥99% purity (tested by HPLC). Based on the price list, it is available as 375 (10mg per vial), with a standard pack size of 10 vials per box. Each vial is sealed with an aluminum-plastic flip-off cap and clearly labeled with product name, dosage, and batch number for easy identification and traceability .

    This product is strictly manufactured under GMP-like conditions, ensuring batch-to-batch consistency and reliability. Each batch undergoes rigorous quality control, including HPLC for purity analysis, Mass Spectrometry for molecular weight confirmation, and appearance inspection. Water content and bacterial endotoxin levels are also tested to ensure product integrity. A Certificate of Analysis (COA) documenting all test results is provided with each batch, and third-party testing is available upon request.

    Key Research Applications: Host defense peptide mechanism studies, membrane interaction and permeabilization research, innate immunity pathway investigations, peptide-lipid biophysics, in vitro cell culture experiments, and peptide-based immunology research compound development.

    Storage and Handling: Store lyophilized powder at -20°C, protected from light, and keep the vial tightly sealed to prevent moisture absorption. LL37 is known to adsorb to surfaces and may require careful handling. Under these conditions, the product remains stable for 24 months from the date of manufacture. Once reconstituted with appropriate sterile solvent (such as sterile water or dilute acetic acid), the solution should be aliquoted and stored at -80°C. Avoid repeated freeze-thaw cycles, as this may compromise peptide integrity.


    Parameter Details
    CAS No. 154947-66-7
    Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
    Molecular Weight 4493.33 g/mol (approximate)
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Storage Condition -20°C, protect from light, keep sealed
    Shelf Life 24 months (unopened, at -20°C)
    Sequence [LL-37, 37 aa]
    Item Specification
    Product Name LL37 (Cathelicidin) Peptide
    CAS No. 154947-66-7
    Molecular Weight 4493.33 g/mol (approximate)
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Dosage Strength Available 375: 10mg per vial
    Pack Size 10 vials per box
    Storage Condition -20°C, protect from light, keep sealed
    Shelf Life 24 months (unopened, stored at -20°C)
    Grade Research Grade
    Application For laboratory research use only

    Shop 99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only-Detailed Image 1


      Product Advantages & Applications  


    LL37 is a high-purity (≥99% by HPLC) synthetic host defense peptide supplied as a lyophilized powder, ideal for innate immunity and membrane interaction research. Each batch undergoes strict quality control, including HPLC and Mass Spectrometry analysis, ensuring batch-to-batch consistency and reliability. The product is in stock with a lead time of 3-5 business days after payment confirmation. Global shipping options include special line/express (40,under5kg, 14days)andUPS/FedEx(40,under5kg, 14days)andUPS/FedEx(70, 7-10 days), with free shipping available for orders over $1000. OEM services such as custom vial dosage and vial cap color are available for bulk orders.

    Research Applications 

    • Host defense peptide structure-function studies

    • Membrane interaction and permeabilization mechanisms

    • Innate immunity and immune signaling pathway research

    • Peptide-lipid biophysics and membrane biophysics

    • In vitro cell culture and immune cell experiments

    • Peptide-based immunology research compound development



    Packaging Structure


     

      


    Shop 99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only-Detailed Image 2 Shop 99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only-Detailed Image 3 Shop 99% Purity LL37 Peptide Cathelicidin Antimicrobial Peptide CAS 154947-66-7 Lyophilized Powder Research Grade for Research Use Only-Detailed Image 4

    Packaging Structure (From Outer to Inner)


    Level Description

    Outer Packaging Standard cardboard box

    Middle Packaging Product box (branded/plain) containing a plastic box inside

    Inner Packaging Plastic box holding 10 glass vials with foam or partition protection

    Vial Clear glass vial, aluminum-plastic flip-off seal, labeled with product name, dosage, and batch number

    Each Plastic Box Contains:
    1 vial of LL37 (5mg per vial, based on your order)
    Each vial is individually sealed with label
    Foam or plastic partition to prevent vials from bumping into each other


    Shipping Methods & Delivery Time
    Shipping Method Cost Delivery TimeSpecial Line/ Express $40 (under 5kg) ~14 days
    UK Special Line Same as above ~25 days (slightly delayed)
    UPS / FedEx $70 7-10 daysShipping Policies


    Policy Details
    Free Shipping On orders over $1000
    Remote Area Fee Some remote areas may incur an extra $35 (as determined by FedEx/UPS)
    Lead Time 3-5 business days after payment confirmation

    Frequently Asked Questions (FAQ)
    Q1: Can I get a sample before placing an order?

    Yes, samples are available upon request. Samples are not provided for free. You will need to pay for both the sample cost and the shipping fee. The sample fee will be deducted from your bulk order payment once you proceed with a formal order.

    Q2: What payment methods do you accept?

    We accept wire transfer (T/T), PayPal, and bank transfer. You may choose the most convenient method for you.

    Q3: How and when can I receive my order after payment?

    Small quantity orders: Shipped via international express (DHL, FedEx, UPS, etc.). Delivery time: 7-10 days after shipment.

    Large quantity orders: Shipped by sea. Delivery time: 15-30 days depending on the destination port.

    Special line: ~14 days delivery time (under 5kg, $40).

    Q4: Can I use my own label or packaging?

    Yes, OEM service is available for bulk orders. We can customize labels, vial dosage, vial cap color, and packaging according to your requirements. Please contact us for details.

    Q5: What is your MOQ (Minimum Order Quantity)?

    Retail MOQ: 1 kit/dosage/item

    Customized packaging (e.g., custom vial size, cap color): 20-50 kits/dosage/item

    Q6: Do you provide a Certificate of Analysis (COA) with each order?

    Yes, each batch comes with a COA (HPLC purity test report). Third-party testing is also available upon request.

    Q7: How should I store the peptide?

    Store at -20°C, protected from light, and keep sealed. Once reconstituted, refrigerate at 2-8°C and use within the recommended timeframe.

    Q8: What documents will be included with my shipment?

    Commercial invoice, packing list, COA, and MSDS will be included with each shipment.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    Lobby of Area B, Area E, Area F and Area G (Central Office Area), Landao Research Center, No.3 Yingbin Road, Yangpu Economic Development Zone, Hainan Province

    Payment Terms:

    TT against copy of documents,D/P

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Certifications:

    Retatrutide,Retatrutide,Retatrutide,Retatrutide

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.