Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - large image1
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - image1
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - image2
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - image3
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - image4
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - image5
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade buy - image6

Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Pharmaceutical Grade

TDS

Unit Price:

$95/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

Sanli Biotechnology

Packaging:

5mg;10mg;20mg;30mg;50mg; 60mg 10vials/box

Price valid (until):

2026-07-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide

  • Product Description

  • Seller Information

  • Description

    Contact me:Lucy

    WhatsApp:+852 9549 4001

    Email:  lucy@sanlibiotechnology.com

    Shop China quality peptide Retatrutide 10mg 20mg 30mg 40mg 50mg 60mg lyophilized powder in stock Reagent Grade-Detailed Image 1 Shop China quality peptide Retatrutide 10mg 20mg 30mg 40mg 50mg 60mg lyophilized powder in stock Reagent Grade-Detailed Image 2



    Shop China quality peptide Retatrutide 10mg 20mg 30mg 40mg 50mg 60mg lyophilized powder in stock Reagent Grade-Detailed Image 3 Shop Chinese Factory Supplies Weight Loss Bodybuilding Tablets High Quality Pharmaceutical Grade-Detailed Image 4 Shop Chinese Factory Supplies Weight Loss Bodybuilding Tablets High Quality Pharmaceutical Grade-Detailed Image 5 Shop Chinese Factory Supplies Weight Loss Bodybuilding Tablets High Quality Pharmaceutical Grade-Detailed Image 6 Shop Chinese Factory Supplies Weight Loss Bodybuilding Tablets High Quality Pharmaceutical Grade-Detailed Image 7 Shop Chinese Factory Supplies Weight Loss Bodybuilding Tablets High Quality Pharmaceutical Grade-Detailed Image 8

    Retatrutide (LY3437943) acetate is a triple agonist peptide for the glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R).

    Retatrutide acetate inhibits human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643, and 0.775 nM, respectively. It exhibits activity on mouse GCGR, GIPR, and GLP-1R with EC50 values of 2.32, 0.191, and 0.794 nM, respectively.

    In vivo, Retatrutide (LY3437943) acetate engages with GCGR and enhances glucose tolerance in an ipGTT by acting through GIP or GLP-1 receptors. Activation via the glucagon receptor by Retatrutide acetate leads to significant weight reduction and increased energy expenditure. Retatrutide acetate can be utilized in research related to obesity.

    Retatrutide, LY3437943

    CAS#: 2381089-83-2

    Molecular Formula: C221H342N46O68

    Items Specification
    Appearance White Powder
    Purity (HPLC) ≥99.0%
    Single Impurity (HPLC) ≤1.0%
    Sodium Content (HPLC) 5.0%-12.0%
    Moisture Content (Karl Fischer) ≤10.0%
    Peptide Content ≥80.0%

    Molecular Weight: 4731.33

    Sequence: H-Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-α-Me-Leu-Leu-Asp-Lys-{diacid-C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-Aib-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

    Storage: Store at 2-8 degrees Celsius in a dry and cool place.

    Packaging: 1g-1kg, plastic bottle

    Intended Use: For scientific research purposes


    Shop China quality peptide Retatrutide 10mg 20mg 30mg 40mg 50mg 60mg lyophilized powder in stock Reagent Grade-Detailed Image 4

    Why choose us  

    1. All peptides and raws purity >=99% purity

    Many HPLC test reports are available (Janoshik).
    2. 100% Safe delivery
    3. Oversea warehouses and stocks: USA, Canada, Europe and Australia.
    4. Cheapest prices in the market, unbeatable!
    5. Payment options: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram

    Company Profile

    Sanli Biotechnology Co., Ltd. is located in HuNan province of China.We specializes in exporting high quality Research chemical, medical intermediate, Pharmaceutical chemicals and so on. Our products are produced on the basis of best technical team, advanced equipment, high qualified management which meet the requirements of security and environmental protection. Quality and service as the highest concept, continuous innovation as the driving force, our products are all over the world.We earned customer trust and created a good reputation during these years. We Supply Free of customs clearance, Double Clearance 100% pass delivery to USA, Canada, Australia,Poland, Italy, Sweden, UK, Czech Republic, Spain, Germany, Netherlands, Mexico, Russia, Ukraine, Kazakhstan.Door to door service.

    With many years of experience, it has fostered an extensive knowledge on the products and market to our company which has built the confidence to our customers with the best.

    Our company offers variety of products which can meet your multifarious demands. We adhere to the management principles of "quality first, customer first and credit-based" since the establishment of the company and always do our best to satisfy potential needs of our customers. Our company is sincerely willing to cooperate with enterprises from all over the world in order to realize a win-win situation since the trend of economic globalization has developed with anirresistible force.

    Shop China quality peptide Retatrutide 10mg 20mg 30mg 40mg 50mg 60mg lyophilized powder in stock Reagent Grade-Detailed Image 5 Shop China quality peptide Retatrutide 10mg 20mg 30mg 40mg 50mg 60mg lyophilized powder in stock Reagent Grade-Detailed Image 6

    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram, etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd like to.



    Pls input...

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide

    Location:

    No. 69, 6th Floor, Building 1, No. 68 Julong Road, Wuhou District, Chengdu, Sichuan Province

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.