Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 high quality 99% purity 5mg/vial, 10vial/kit
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - large image1
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - image1
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - image2
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - image3
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - image4
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - image5
LL37 high quality 99% purity 5mg/vial, 10vial/kit buy - image6

LL37 high quality 99% purity 5mg/vial, 10vial/kit

TDS

Unit Price:

$83-93/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Brand:

STTY

Packaging:

5mg/vial, 10vial/kit

Price valid (until):

2026-09-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    LL37 is a synthetically produced, highly active peptide/bioactive molecule. It’s manufactured using advanced solid-phase synthesis techniques, resulting in a purity of ≥99%. The product exhibits batch stability, high activity, and well-controlled impurities. As a research-grade reagent, it’s ideal for cell experiments, mechanism studies, pharmacological research, and formula development. It provides high-quality materials for research in related fields.


    We’re currently running a popular 10% off promotion

    Whatsapp:+852 98497616


    Sincerely look forward to your inquiries.

    Product
    LL37
    Specifications 5mg/vial, 10vial/kit
     Purity  ≥99%
    Origin Hong Kong
    Payments Wise, Credit cards, PIX, Bitcoin, USDT, and bank transfers
    Shipping DHL UPS EMS
    Delivery Time 7-12 days after your order is confirmed


      Core research effectiveness


    1、Highly active bioregulation: Precisely targets cell signaling pathways/molecular targets, participating in physiological processes such as metabolic regulation, cell repair, tissue maintenance, and state optimization, providing reliable models for related mechanism research.
    2、Stable, efficient, and easy to use: The lyophilized powder has strong morphological stability, is easily soluble, and retains activity well. It is compatible with various experimental systems, easy to operate, highly repeatable, and reduces experimental errors.
    3、Safe and low-interference: Research-grade quality control standards, sterile, pyrogen-free, endotoxin-free, with no additional impurities interfering with experimental results, suitable for long-term research and large-scale experiments.
    4、Multi-scenario scientific research adaptation: Suitable for research directions such as metabolic mechanisms, cell regeneration, tissue maintenance, active ingredient development, and in vitro model construction, with a wide range of applications.


    Mechanism of action


    ✅ High-purity quality control: ≥99%, COA quality inspection report provided for each batch, quality traceable.
    ✅ Advanced process: solid-phase synthesis + purification technology, low impurities, high activity, and strong batch consistency.
    ✅ Complete specifications: Multiple dosage specifications are available to meet different experimental scales and research needs.
    ✅ Stable and easy to store: Stable at -20°C for a long time, not easily degradable, with long-lasting activity, reducing storage costs.


    Applicable Research Areas 


    Research on cell signaling pathways and molecular mechanisms
    Research on the relationship between metabolic regulation and energy homeostasis
    Research on cell repair, regeneration, and tissue maintenance
    Research on bioactive ingredient screening and formulation development
    Construction of in vitro experimental models and exploration of pharmacological mechanisms
    Basic research and academic research applications in related fields


    Shop Anti-wrinkle GHK-Cu 50mg 100mg GHK Cu spot Anti-aging Skincare and Beauty Treatments For Various Wrinkles and Maintain-Detailed Image 4
    Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 2
    Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 3
    Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 4 Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 5
    Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 6
    Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 7
    Shop LL37 high quality 99% purity 5mg/vial, 10vial/kit-Detailed Image 8
    Shop Anti-wrinkle GHK-Cu 50mg 100mg GHK Cu spot Anti-aging Skincare and Beauty Treatments For Various Wrinkles and Maintain-Detailed Image 5

    Certificates
    • LL37 high quality 99% purity 5mg/vial, 10vial/kit Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    11

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.