Product Description
LL-37 is a synthetic 37‑amino‑acid cationic peptide with the sequence H‑Leu‑Leu‑Gly‑Asp‑Phe‑Phe‑Arg‑Lys‑Ser‑Lys‑Glu‑Lys‑Ile‑Gly‑Lys‑Glu‑Phe‑Lys‑Arg‑Ile‑Val‑Gln‑Arg‑Ile‑Lys‑Asp‑Phe‑Leu‑Arg‑Asn‑Leu‑Val‑Pro‑Arg‑Thr‑Glu‑Ser‑OH (one‑letter code: [LL-37, 37 aa]). It has a molecular formula of C₂₀₅H₃₄₀N₆₀O₅₃ and a molecular weight of approximately 4493.33 g/mol. LL-37 is the only known human cathelicidin – a class of host defense peptides that form a critical component of the body‘s innate biological systems. It is constitutively expressed in human skin and is significantly upregulated in response to environmental stressors such as UV radiation, mechanical stimulation, and inflammatory signals.
In cosmetic formulation research, LL-37 is of interest for its potential to help maintain healthy skin barrier function, support the skin‘s natural adaptive responses to environmental stress, and promote a balanced, radiant complexion.
.
1. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.
Sales manager: Eira
whatsapp:+8619304441463
whatsapp:+852 9546 9358
Email: sales01@cnspks.com
1. Advanced Manufacturing Capabilities
Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
2. Innovation & Customer Commitment
Reliable Supply Chain: Competitive pricing & timely global delivery.
Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
Q1: May I get one sample before placing order?
Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.
Q2: Which payment is available for your company?
Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.
Q3: How and when can I get my goods after payment?
Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.
Q4: Is there any possible to use my appointed label or package?
Re: Yes. If needed, we'd lik.
1. Expertise in Peptide Synthesis
Extensive Experience: 7 Years of expertise in synthetic peptide development.
Skilled Team: Experts in solid-phase and liquid-phase synthesis.
2. Advanced Manufacturing Capabilities
Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
3. Innovation & Customer Commitment
Reliable Supply Chain: Competitive pricing & timely global delivery.
Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
4. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
5.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
6.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.
Why Choose Our Peptides?
- Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
- Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .
-
-
Why Partner with us?
Quality Assurance:
Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.
Flexible Supply:
Available in multiple formats. Consistent lead times with flexible production capacity.
Competitive Edge:
Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.
Technical Support:
Full documentation and formulation guidance.