Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > 375 Large quantity discounts, factory direct sales, purity 99.9%
375 Large quantity discounts, factory direct sales, purity 99.9% buy - large image1
375 Large quantity discounts, factory direct sales, purity 99.9% buy - image1
375 Large quantity discounts, factory direct sales, purity 99.9% buy - image2
375 Large quantity discounts, factory direct sales, purity 99.9% buy - image3
375 Large quantity discounts, factory direct sales, purity 99.9% buy - image4
375 Large quantity discounts, factory direct sales, purity 99.9% buy - image5
375 Large quantity discounts, factory direct sales, purity 99.9% buy - image6

375 Large quantity discounts, factory direct sales, purity 99.9%

TDS 1 Inquiries

Unit Price:

$1-1.2/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99.9%

Port:

SHEN ZHEN

Brand:

customization

Packaging:

10 pieces per box

Price valid (until):

2026-10-14

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Whatsapp:+85265524367

    I. Topical Skin Application (Serum, Cream, Wound Dressing, Mask) – Skincare and Repair Benefits

    1. Broad-spectrum antibacterial and anti-acne action to eliminate recurring inflammatory acne
    Directly disrupts the cell membranes of *Cutibacterium acnes, Staphylococcus aureus*, and *Malassezia*, effectively killing bacteria responsible for pustular and inflamed acne lesions while minimizing resistance development.
    Penetrates bacterial biofilms to clear deep-seated microbial buildup in pores, improving blackheads, back acne, and scalp folliculitis.
    Suppresses mite-related inflammation, alleviating redness, burning, and pruritic papules associated with rosacea.

    2. Repair damaged skin barrier to improve sensitivity, dryness, itching, and redness
    Promotes keratinocyte proliferation and strengthens intercellular connections in the stratum corneum, compensating for insufficient LL-37 secretion in sensitive skin.
    Downregulates pro-inflammatory cytokines TNF-α and IL-6, rapidly reducing redness and soothing seasonal irritation, hormonal-induced flushing, and recurrent heat sensations.
    Neutralizes external irritants and toxins, reducing skin stress caused by UV exposure, skincare products, and airborne particulates.

    3. Accelerate healing of superficial wounds, minor injuries, and acne scars
    Induces keratinocyte migration and promotes neoangiogenesis, shortening recovery time for abrasions, epidermal breaks, and post-treatment trauma from aesthetic procedures.
    Stimulates fibroblasts to secrete collagen and fibronectin, balancing collagen metabolism to reduce scar formation and fade raised or depressed acne marks.
    Clears apoptotic inflammatory cells from wound sites, reduces post-inflammatory hyperpigmentation, and fades both red and dark acne scars.

    4. Anti-aging and firming effects to minimize fine lines
    Eliminates UV-induced free radicals, reducing photoaging-related fine lines, rough texture, and sagging.
    Inhibits matrix metalloproteinases (MMPs), preserving dermal collagen density, softening dry lines, and enhancing skin plumpness.

    5. Additional benefits when applied topically to the scalp
    Suppresses scalp fungi and harmful bacteria, improving oily scalp, dandruff, itching, and folliculitis; repairs scalp barrier function and reduces hair breakage.

    II. Oral / Sublingual Use (Powder, Capsules, Lozenges) – Systemic Mucosal Immune Regulation

    1. Broad-spectrum systemic antibacterial and antiviral activity to reduce infection risk
    Inhibits Gram-positive and Gram-negative bacteria, fungi, and enveloped viruses such as influenza and herpes, reducing colonization of pathogens in respiratory and gastrointestinal tracts.
    Breaks down bacterial biofilms, helping manage chronic recurrent infections: chronic pharyngitis, recurrent tonsillitis, periodontitis, and oral ulcers.
    Neutralizes bacterial endotoxins, alleviating post-infection symptoms like body aches, fatigue, and low-grade fever.

    2. Comprehensive mucosal barrier reinforcement (core benefit of oral use)
    Forms a natural protective layer across oral, pharyngeal, airway, intestinal, and urogenital mucosa:
    Respiratory tract: Repairs airway epithelium, reducing seasonal dry cough, allergic rhinitis, and frequent colds.
    Digestive tract: Strengthens gut barrier, improving leaky gut, chronic enteritis, bloating, diarrhea, and food intolerances.
    Oral mucosa: Alleviates recurrent oral ulcers, gingival inflammation, and halitosis.
    Urogenital mucosa: Relieves mild dryness and discomfort due to dysbiosis and light itching.

    3. Dual-directional regulation of innate immunity and balanced inflammation
    For individuals with weak immunity: Activates NK cells and macrophages, boosting baseline resistance and reducing susceptibility to seasonal infections.
    For those with chronic low-grade inflammation: Suppresses excessive inflammatory responses, relieving persistent body aches, stiff shoulders and neck, fatigue, and edema.
    Activates the vitamin D immune pathway, synergistically enhancing the body’s endogenous production of LL-37 for long-term immune support.

    4. Gut health maintenance and improved digestion via the gut-brain axis
    Inhibits overgrowth of harmful gut bacteria, restoring microbiome balance and reducing indigestion, bloating, and sticky stools.
    Repairs damaged intestinal epithelium, improving nutrient absorption and addressing chronic digestive weakness and fatigue.
    Reduces transmission of intestinal inflammation to the brain, alleviating inflammatory-related irritability, poor sleep quality, and low mood.

    5. Long-term respiratory care
    Ideal for individuals with chronic sleep deprivation, smoking habits, or exposure to dusty environments—reduces chronic airway irritation and morning phlegm, as well as throat foreign-body sensation.

    Shop 2S10-Detailed Image 1 Shop 2S10-Detailed Image 2 Shop 2S10-Detailed Image 3 Shop 2S10-Detailed Image 4 Shop 2S10-Detailed Image 5 Shop 2S10-Detailed Image 6 Shop 2S10-Detailed Image 7 Shop 2S10-Detailed Image 8 Shop 2S10-Detailed Image 9 Shop 2S10-Detailed Image 10 Shop 2S10-Detailed Image 11 Shop 2S10-Detailed Image 12

    Hazard Identification

    Classification of the substance or mixture

    no data available

    GHS label elements, including precautionary statements

    Pictogram(s) no data available
    Signal word

    no data available

    Hazard statement(s)

    no data available

    Precautionary statement(s)
    Prevention

    no data available

    Response

    no data available

    Storage

    no data available

    Disposal

    no data available

    Other hazards which do not result in classification

    no data available

    Shop 2S10-Detailed Image 13
    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Items Specifications
    Product Name LL37
    Purity 99.9%
    Storage Condition Seal and store in cool dry place

    Certificates
    • 375 Large quantity discounts, factory direct sales, purity 99.9% Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.