Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer.
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - large image1
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image1
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image2
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image3
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image4
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image5
NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image6

NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer.

TDS 1 Inquiries

Unit Price:

$1-1.3/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHENZHEN

Brand:

custom-MADE

Packaging:

10 pieces per carton

Price valid (until):

2026-10-16

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WHATSAPP:+85265540844

     

       Company Profile 

     


    Hong Kong Biopetide Research Limited  is a high-tech company specializing in the research, production and sales of various peptide products. It has advanced laboratories and strict quality control, ensuring the safety and effectiveness of its certified products. Our products have been adopted by numerous well-known enterprises in China, the United States, Russia, North Africa, etc., and have won wide acclaim from customers. If you need any assistance, please contact us immediately! We are proud to introduce our high-quality freeze-dried powder and peptide product series, which are suitable for various applications. Our products include professional whitening peptides, slimming peptides, shaping peptides and multi-element peptides, each designed to meet specific formulation requirements. These peptides are available in various forms, including crystals, liquids and powders, and offer options such as white crystals and white powders. Our products integrate the latest technology to ensure optimal performance and reliability. The versatility of our peptides makes them an ideal choice for various applications, enhancing product efficacy and stability. We ensure that each batch of freeze-dried powder and peptides meets strict quality standards, providing you with outstanding products. Our relentless pursuit of innovation and quality makes our peptides a reliable choice for your formulation needs.Our products are exported to 130+ countries and regions and can be delivered within 5-14 days. We can provide OEM/ODM support. We have 10 professional after-sales personnel who are available 24/7 to respond to customer needs. Contact us immediately to learn more. We hope to establish stable and long-term strategic partnerships with domestic and foreign suppliers and customers, working together to create a bright future.


     

      Product Detail  

     


     This newly upgraded high-purity active functional material is tailor-developed for global beauty and skincare formulation systems. As a high-end cosmetic-specific raw material, it is perfectly applicable to full scenarios including high-end skincare product research and development, commercial formula production and cutting-edge cosmetic scientific research.
      It owns four core advantages: ultra-high purity, excellent solubility in all systems, long-term physicochemical stability and broad formulation compatibility. With uniform and fine texture as well as stable physicochemical properties, this material can be well compatible with various complex skincare formulations such as aqueous phases, oil phases and emulsion systems. It will not lead to formulation defects including stratification,precipitation, system flocculation and antagonistic inactivation of active ingredients after addition, greatly lowering formula debugging difficulty and enhancing the stability of finished cosmetic products.
      Unlike common industrial-grade equivalent materials available on the market, our product implements full-chain production and quality control in line with strict international cosmetic ingredient quality standards.
      Acomprehensive traceable quality inspection system is established covering the whole process from raw material incoming acceptance, standardized production to finished product delivery from warehouse.

      WHY CHOOSE US

    Semaglutide is an oral medication designed to block the effects of endothelin, a natural substance in the body that narrows blood vessels. By inhibiting endothelin, semaglutide helps relax blood vessels, improving blood flow and reducing stress on the heart and lungs.

    Approved Uses of Semaglutide:

    1. Pulmonary Arterial Hypertension (PAH): Semaglutide is primarily used to treat PAH, a disease in which high blood pressure in the lungs makes it difficult for the heart to pump blood effectively.

    2. Secondary Raynaud's Phenomenon (unlabeled use): In some cases, semaglutide is used to reduce the frequency and severity of Raynaud's episodes.

    How does semaglutide work?

    Semaglutide works by blocking endothelin receptors (ET-A and ET-B) on the smooth muscle of blood vessels. This action reduces blood vessel constriction, improves oxygen delivery to tissues, and relieves symptoms such as dyspnea and fatigue associated with pulmonary hypertension.

    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. Provide samples before regular order. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

    FAQ 

     


    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price. 

    Q4: Do you accept VISA business credit card?

    A: Sorry we don't accept VISA credit card,
    We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel  lose.
    Our long association with  our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    Our clients will confirm this as even they struggle to find them without help at times.
    But in spite of our best efforts it is still possible  will seize a small number of packages.
    In this circumstance we promise reship free  to establish  long term relationship.

       Package & Delivery

     

    Product Packing:10mg/vial 10vials/box15mg/vial 10vials/box20mg/vial 10vials/box (Customized according to customer requirements)30mg/vial 10vials/box (Customized according to customer requirements)

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).


    Shop SM10-High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 1 Shop SM10 High purity, factory direct supply, bulk discounts available.-Detailed Image 1

    Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 3 Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 4 Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 5 Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 6

    Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 7 Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 8 Shop F410--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 9 Shop 375--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 10 Shop MT10-- High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 11 Shop 5AM--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 12 Shop 5AM--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 13 Shop 5AM--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 14 Shop 10AM--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 15 Shop 10AM--High purity, large quantity, discounted price. Direct delivery from the manufacturer.-Detailed Image 16

    Items Specifications
    Product Name NP810
    Purity 99%
    Specification 10 vials per box
    Appearance White Powder

    Certificates
    • NP810--High purity, large quantity, discounted price. Direct delivery from the manufacturer. Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.