Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - large image1
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - image1
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - image2
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - image3
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - image4
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - image5
Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do buy - image6

Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do

TDS 1 Inquiries

Unit Price:

$10-11/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

Guangdong

Brand:

OEM

Packaging:

5mg/vial 10vials/box

Price valid (until):

2026-08-20

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


        LL-37 (Cathelicidin) Product Description



    LL-37, also known as human cathelicidin antimicrobial peptide (hCAP-18/LL-37), is a synthetic cationic peptide derived from the human cathelicidin family. This product is supplied as a sterile, white to off-white lyophilized powder, formulated exclusively for laboratory research applications.

    LL-37 is a naturally occurring peptide with a conserved amphipathic α-helical structure, designed for experimental studies focused on immunology, cell biology, and peptide-membrane interactions in laboratory settings. It demonstrates high structural stability, excellent aqueous solubility, and consistent performance across a wide range of in vitro and in vivo research protocols, making it a reliable tool for scientific investigation.

    Our LL-37 is manufactured under strict quality control standards, with rigorous testing at every production stage. Each batch achieves a minimum purity of 99% as verified by HPLC analysis, and is accompanied by a comprehensive Certificate of Analysis (COA), including identity confirmation via mass spectrometry, sterility validation, endotoxin testing, and moisture content analysis. This ensures minimal impurities, consistent experimental results, and reliable data reproducibility for all research projects.

    The peptide is widely utilized in laboratory studies focused on immunobiology, cellular defense mechanisms, peptide-membrane interaction research, and preclinical investigations of host response regulation. It is supplied in sterile, sealed glass vials, with flexible packaging options to meet diverse research scale needs, from small-scale lab experiments to large preclinical research programs.

    LL-37 is highly soluble in aqueous solutions, simplifying reconstitution and handling for various experimental workflows. It should be stored at -20°C, protected from light and moisture, to maintain long-term stability. The shelf life of the lyophilized powder is 24 months when stored under recommended conditions, ensuring a reliable supply for ongoing research projects.

    Important Notice: This product is for laboratory research use only. It is not intended for human or veterinary use, nor for use in diagnostic, therapeutic, or clinical applications. All handling and use must comply with relevant laboratory safety guidelines and regulatory requirements.
    Items Specifications
    Molecular Formula C₂₁₃H₃₅₉N₆₇O₃₉S
    Appearance White to off-white lyophilized powder
    Purity ≥99% (HPLC)
    Packaging 5mg/vial 10vials/box
    Payment Alipay, bank transfer, USDT, USDC, BTC, OXC and Bitcoin.
    MOQ 10vials
    Certificate COA


      LL-37 (Cathelicidin) Product Advantages 



    Our LL-37 (Cathelicidin) peptide is engineered to deliver exceptional reliability and performance for laboratory research, with core advantages tailored to meet the strict requirements of scientific research applications:

    First, it features ultra-high purity verified by rigorous HPLC testing, with a minimum purity of 99% guaranteed for every batch. This ensures minimal impurities, consistent experimental results, and reliable data reproducibility across all research protocols, eliminating variables that could compromise study outcomes.

    Second, we implement stringent quality control throughout the entire manufacturing process. Each batch is fully tested and accompanied by a comprehensive Certificate of Analysis (COA), including identity confirmation via mass spectrometry, sterility validation, endotoxin testing, and moisture content analysis, guaranteeing consistent quality and reliability for every research project.

    Third, the product is formulated as a sterile, white to off-white lyophilized powder with excellent aqueous solubility. This user-friendly format simplifies reconstitution and handling, making it compatible with a wide range of in vitro and in vivo research workflows, from cell culture studies to preclinical animal models.

    Fourth, we offer flexible, research-oriented packaging options, including 5mg, 10mg, and 50mg sterile sealed glass vials, tailored to meet diverse research scale needs, from small-scale lab experiments to large preclinical research programs.

    Fifth, our LL-37 demonstrates long-term stability under recommended storage conditions. When stored at -20°C, protected from light and moisture, the lyophilized powder maintains full biological activity for 24 months, reducing waste and ensuring a reliable supply for ongoing research projects.

    Sixth, we maintain a large, stable inventory with fast global shipping capabilities. We offer door-to-door delivery via reliable logistics partners, ensuring timely delivery to research institutions worldwide, with professional, temperature-controlled packaging to maintain product integrity during transit.

    Finally, we provide professional, responsive after-sales support for research customers, including clear product documentation, dedicated technical assistance, and fast response to any research-related inquiries, ensuring a smooth and seamless experience for all laboratory partners.

    Important Notice: This product is for laboratory research use only. Not for human or veterinary use, not for diagnostic, therapeutic, or clinical applications. Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 1 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 2 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 3 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 4 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 5   Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 6 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 7 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 8 Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 9


      Uses and Functions 


      Its primary roles can be summarized in three key aspects:
    1. Rapid Response Unit
    When bacteria, fungi, or enveloped viruses invade, LL-37 acts like a “natural antibiotic,” directly attacking and physically destroying or inhibiting these pathogens with speed.
    2. Alarm Signal & Commander
    Upon detecting pathogens or tissue damage, LL-37 serves as an “alarm signal,” releasing chemical cues to recruit more immune cells (like neutrophils and macrophages) to the “battlefield.” Simultaneously, it acts like a “field commander,” intelligently modulating the intensity and duration of the inflammatory response—effectively eliminating threats while preventing excessive immune reactions that could harm the body’s own tissues.
    3. Repair Engineer
    Once the battle subsides, LL-37’s work continues. It transitions into the role of a “repair foreman,” promoting the migration and proliferation of skin cells, stimulating the formation of new blood vessels, and actively clearing the “battlefield” to accelerate wound healing and tissue regeneration.


    Mechanism of Action 



    1. Physical Breach (Against Microbes)

    The LL-37 molecule carries a positive charge, while the cell membranes of bacteria and fungi carry a negative charge. They attract each other like magnets. Once close, LL-37 inserts itself and disrupts the microbial membrane structure, effectively “punching holes” in it. This causes the microbe’s internal contents to leak out, leading to rapid death. This mode of attacking the overall membrane structure makes it very difficult for bacteria to develop resistance, unlike with conventional antibiotics.

    2. Sending Signals (Commanding the Immune System)

    LL-37 itself is a crucial signaling molecule. When released at sites of infection or injury, it acts like a “flare” or a “homing beacon,” guiding other immune cells. It tells immune cells “where the enemy is,” instructs them on how to coordinate the attack, and signals when to stop fighting and begin repair work.

    3. Promoting Growth (Repairing Damaged Tissue)

    During the repair phase, LL-37 “communicates” with cells like skin cells and vascular endothelial cells, activating their internal growth signaling pathways. This is akin to giving repair cells the “green light,” encouraging them to migrate faster to the wound site, proliferate, and form new blood vessel networks, thereby efficiently completing the reconstruction task.


     


      Benefits 



    • Broad-Spectrum and Potent: Effective against a wide range of common pathogens, including some drug-resistant bacteria.

    • Low Resistance Risk: Its unique physical mode of action significantly reduces the risk of pathogens developing resistance.

    • Intelligent Modulation: Not only initiates immune attack but also precisely controls the level of inflammation, preventing excessive immune damage.

    • Promotes Healing: Seamlessly bridges the “defense” and “repair” processes, making it an ideal promoter of tissue regeneration.

    • Naturally Safe: As an endogenous substance, it has high biocompatibility and typically does not cause strong side effects or allergic reactions.



    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 10
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 11
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 12
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 13
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 14
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 15
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 16
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 17
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 18
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 19
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 20
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 21
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 22
    Shop High Purity LL-37 LL37 CAS 154947-66-7 hCAP-18 C-terminal Cathelicidin Antimicrobial Peptide Research Grade-Detailed Image 23

    Certificates
    • Biomedical Laboratory Reagent LL37 LL-37 Synthetic Cathelicidin hCAP-18 Fragment Antimicrobial Peptide High Activity Polypeptide With Full COA Test Do Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

    Location:

    RM 701, UNIT 108, 7/F, TWR B NEW MANDARIN PLAZA 14 SCIENCE MUSEUM RD TSIM SHA TSUI HONG KONG

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.