Product
Supplier
Encyclopedia
Inquiry
LL-37 buy - large image1
LL-37 buy - image1

LL-37

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

pharmaceutical grade

Content:

99%

Port:

shanghai

Packaging:

25kg/Cardboard Drum

Price valid (until):

2024-04-04

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Dyes,Textile agent,Medical intermediate,API,Pigments,Basic Chemicals

  • Product Description

  • Seller Information

  • Description

    Introduction

    Items Specifications
    Product name  LL-37
    CAS NO. 154947-66-7
    Molecular formula  C205H340N60O53
    Applications Intermediates for organic synthesis.
    Purity 98%
    Shipping conditions Conventional transport


    You can ask us for quotation and product information via Email, Phone, WhatsApp and other channels.

    Email: zoeliu@skygroupchem.com

    WhatsApp: +86 17371389751

    Phone:+86 17371389751

    Who we are


    SKYCHEM GROUP, founded in 1999, provides a wide range of products and technology exports to more than 1,000 customers in more than 60 countries, including dyes, chemical additives, and medical intermediates.There are 55 employees, all of whom have bachelor's degree or above, 13 of whom have doctor's degree or master's degree.


    In 2013, the Group established a wholly-owned subsidiary HANGZHOU CHUNGYO CHEMICALS CO., LTD. with a factory located in Fujian Province, fully equipped with commercial production capacity, providing global chemical enterprises with core services from pilot and pilot to scale-up production.



    1. Why choose us


    Quality guarantee


    Product quality management is the top priority of BidD's internal management. Through strengthening staff training, improving testing technology, improving testing indicators, and constantly improving every link in quality control, we ensure that the quality of each batch of products meets customer requirements. All along, Chungyo's business activities are carried out in strict accordance with international quality management standards, and the company has obtained the ISO9001:2015 international quality system certification from Swiss General Standards Company (SGS)


    Chungyo has a large-scale production base, can provide customers with customized production services. We strictly abide by ISO standards for product control, and employees are required to receive formal training at the beginning of entering the company's service, and regularly hold training and assessment. To ensure that all products are produced by well-trained staff following the prescribed procedures and procedures.


    Each batch of our products is accompanied by a detailed quality inspection list, including: product name, batch number, purity, production date, reinspection period, storage conditions, analysis data and other detailed data. Our guidance document is based on ICH Q7 Good Manufacturing Practice, which also provides formal induction and regular training for the company's relevant employees.


    In our quality control system, we use the following testing steps to ensure the quality of each batch of products:


    Raw material inspection
    Intermediate quality testing
    Product quality inspection
    Product Analysis and Inspection Certificate (COA)
    Keep samples for at least one year for each batch of products



    In product quality control, we use the following techniques: 


    Mass spectrometry (LMS)
    Spectral technology (infrared, ultraviolet)
    Polarimetry
    Metal content analysis
    Amino acid analysisRaw material inspection
    Elemental analysis
    Amino acid analysisRaw material inspection




    R&D Base


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 1







    LC-MS:1 Set

    LC-Solution Lite:4 set

    Agilent technologies HPLC:1 set

    Thermo Fisher CAD HPLC:1 set

    Shimadzu GC:2 set



    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 2















    R&D laboratory: 40 sets of fume hoods

    Pilot laboratory: 200 square meters

    Equipped with 6 sets of high and low temperature reaction machines (-80 degrees -200 degrees)

    Glass reactor: 30,50,100 L (4 sets)

    4 sets of hydrogenation reactors (1 L, 5 L, 25 L, 50 L)













    Production base



    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 3

    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 4


    The factory has 50 liters to 3,000 liters of reactor, equipment to meet various production conditions; The total volume of the reactor is 82m3;At present, the two workshops have been put into operation, and the total number of reaction kettle enamel kettle and stainless steel kettle is 65.


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 5


    The factory has set up physical and chemical laboratory, chromatography laboratory, sampling room/sample retention room/stability laboratory/reagent room and other areas, as well as reserved microbiology laboratory, fully meet the requirements of raw materials and finished products of the indicators of testing.


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 5


    R&D Service


    Shop 2-Chloro-3',4'-dihydroxyacetophenone-Detailed Image 6


    Second phase technical reform plan:


     In November 2021, it has been started, mainly in the first and second workshops, and the investment of this technical transformation is about 60 million yuan. The second phase

    The technical transformation construction drawing design has been completed in 2022, and the safety and environmental assessment work will be completed soon.

    The first and second workshops are equipped with glass lined reactors of 3000L, 4000L, 5000L, 6300L and 10000L,41 sets in total, can do chlorination, nitrification and other high-risk processes, equipped with 500L, 2000L ultra-low temperature reactor 2 sets, equipped with 500L,1000L high temperature kettle 2 sets, can meet the needs of high temperature and ultra-low temperature special reaction.

    The second phase of the technical reform will be in one workshop area, about 500 square meters of GMP workshop and its pre-treatment area will be set up separately, with 3 lines

    Independent production line, reactor specifications of 300L, 500L, a total of 6, can meet the production of 15 to 20 tons of raw materials.

    In the second phase of technical reform, three hydrogenation reactors of 500L, 1000L and 2000L will be added to the hydrogenation area of the fourth workshop.Adjust the drying area of the third workshop and add 4 sets of 2000L~3000L glass lined kettle.


    1. FAQ



    1.What's your payment terms?

    T/T、L/C or have a negotiation

    2.What's your shipping time?

    We have bulk in stock, which means we can ship it to you immediately.

    3.How do you ship the order normally?

    For large qty order,ship the goods by sea. For small qty order, by air or express. We supply optional express for you, including DHL.FEDEX.UPS.EMS and so on

    4.Do you supply samples?

    Yes,but we have to charge as it is cost to deliver abroad.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Dyes,Textile agent,Medical intermediate,API,Pigments,Basic Chemicals

    Location:

    Room 507, Dongnan Technology R&D Center, No.438 Jincheng Road, Beigan Street, Xiaoshan District,Hangzhou City,Zhengjiang Province,China

    Payment Terms:

    TT against copy of documents,L/C,100% TT in advance

    Average lead Time:

    20

    Total Annual Revenue:

    $25 million-$50 million

    Total Employees:

    51-100

    Year of Establishment:

    2013

    WHO WE ARE
    Hangzhou Chungyo Co., Ltd. is a wholly-owned subsidiary of skychem group.Since the company was founded in 1999.Chungyo has become one of the leading chemical product specializing in chemical product development, production and export, with an annual production capacity of 60,000 tons.
    In the course of our operation in the chemical industry, we have proved that we are a high quality export supplier. Due to the successful operation in the domestic market in the past 15 years, we will expand overseas markets from 2014. Now our auxiliary products, dyes, pharmaceutical intermediates and other products with stable quality, pure composition, efficacy, consistency and so on are widely praised.
    We will adhere to the principle of "integrity first", and domestic and foreign customers mutual benefit, hand in hand.
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.