Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - large image1
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image1
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image2
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image3
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image4
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image5
Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image6

Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou port

Brand:

XINKAIYUE

Packaging:

10mg 20mg/vial,10 vials/box

Price valid (until):

2025-01-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Peptides

  • Product Description

  • Seller Information

  • Description

    Sales manager: niki
    whatsapp:+8615030922776
    Email: niki@xtmingheng.com

    Product Details

    Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 1

    Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 2 Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 3 Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 4

    Product name LL37 color White
    Product synonyms AntibacterialProteinLL-37(huMan), LL37, CAMP; Antibacterial Protein LL-37  (human); LL-37 (trifluoroacetate salt); CathelicidinLL37(human);LL-37,LL37,CAMP;LL-37humanacetate Paypment ways Paypal;
    BankTransfer;
    MoneyGram;T/T
    CAS number 154947-66-7 Shipping ways UPS;FedEx;DHL;EMS;by air;by sea
    Molecular formula C205H340N60O53 Specification 5mg 10mg 15mg/vial
    Molecular weight
    Origin China
    EINECS number 211-519-9 Production Capacity 5000kg/month
    form Lyophilized powder Customized Acceptable
    Solubility Soluble to 1 mg/ml in water MOQ 1 box

    LL-37

    Bioactive 
    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 5 Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 6

    Company Introduction

    XINKAIYUE is mainly engaged in the export of fine chemicals, cosmetic raw materials, food additives, pharmaceutical intermediates and other products,  which are widely used in medicine, health products, cosmetics, nutritional supplements, food additives and other fields.
    Our company has its own research and development team and production plant. Our company is dedicated to the development of  international markets. Our products are mainly exported to many countries and regions,
    such as Europe, America, South-east Asia, the Middle East and Africa etc. 
    In addition,we have professional and experienced engineers and scientists, providing new polypeptide drug biosynthesis solutions, which help partners stay  ahead of the polypeptide drug discovery, clinical development and market production.

    Company photos

    Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 7

    Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 8


    Our advantage

    rich experience
    1. Our company is a professional and leading factory with many years of experience in the pharmaceutical field in China.
    2. We have good feedback from customers all over the world.
    OEM service
    1.Add customer logo
    2. Redesign labels and packaging boxes according to customer requirements
    3. Bottle cap color can be customized
    Shipping service
    1. Shipped within 48 hours after payment is received.
    2. Small orders are shipped via express door-to-door.
    3. The goods arrive in 7-10 days
    24 hours service
    1.Reply your inquiry within 10 hours
    2. Continuously track goods and update information to customers
    3. After-sales service at any time

    Packaging and shipping

    Shop Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37-Detailed Image 10

    FAQ:

    Q: How to order this product?
    A: You can click "chat now" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

    Q: How long can I receive my ordered goods?
    A: We ship by express door to door; you can receive it in 7-10 workdays.

    Q: What liquid should I add into the vial? And how much liquid needed?
    A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.(Depends on the specific product situation)

    Q: Will I have any side effects after using peptide?
    A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.

    Q: How to store it?
    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Peptides

    Location:

    Shop No. 47, Jixin Plaza, No. 26 Renmin Avenue, Renmin Street, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    L/C,O/A,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2019

    Haikou Mingheng Technology Co., Ltd. is a modern and advanced enterprise specializing in the production and export of pharmaceutical intermediates, plant extracts, and other products. Products are widely used in health products, peptides and other fields. Our plant covers an area of 1000 m². The proposed workshop will be built according to GMP standards. We provide our customers with quality products and first-class service. Now, we can provide G-KG service to our customers.

    • High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.

    • Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.

    • Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.

    • Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.

    • Comprehensive Product Range: Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

      Company Profile

     




  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.