Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - large image1
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - image1
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - image2
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - image3
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - image4
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - image5
TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale buy - image6

TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale

TDS 9 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

qingdao

Brand:

HM

Packaging:

10mg 20mg/vial,

Price valid (until):

2025-04-23

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Propylene glycol

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Product name Teriparatide acetate
    color White
    Product synonyms FRAGMENT1-34;
    PARATHYROIDHORMONE(HUMAN,1-34);
    Teriparatideacetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;

    Paypment ways Paypal;
    BankTransfer;
    MoneyGram;T/T
    CAS number 52232-67-4
    Shipping ways UPS;FedEx;DHL;EMS;by air;by sea
    Molecular formula C172H278N52O47S2
    Specification 5mg 10mg 15mg/vial
    Molecular weight 3890.49792
    Origin China
    EINECS number 640-978-1
    Production Capacity 500000vials/week
    Storage conditions ‘-20°C
    Customized Acceptable
    Solubility Soluble to 0.40 mg/ml in water
    MOQ 1 box



    • Teriparatide :
    • mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.
    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.



    Shop China Supplier Teriparatide Acetate 52232-67-4 with Safe Custom high quality good price-Detailed Image 1 Shop China Supplier Teriparatide Acetate 52232-67-4 with Safe Custom high quality good price-Detailed Image 2


    Applicantion

    Teriparatide Acetate is effective in reducing the incidence of new vertebral and non-vertebral fractures in patients with severe osteoporosis.

    It has also demonstrated improvements in bone density, bone turnover markers and skeletal microarchitecture. Furthermore, Teriparatide acetate has a relatively short half-life, which means that any adverse effects can be quickly reversed once the treatment is discontinued.

     


     Our Advantage    



    1. Rich experience.
    Our company is a professional production leading factory in China in pharmaceutical area of many years

    our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country,

    and we have got very good feedback from our customers, we had Established long friendly relations of cooperation.


    2. Great quality, purity and favourable.
    Good quality is one of our secret success, welcome order the samples, MOQ just 1 grams.


    3. Safe and fast delivery.
    We have stock, so we can delivery quickly at the very day when receive the payment.

    We have special way could ship 0.01kg to 3.5kg products a time. We offer melting powder into liquid service.

    And ship the liquid in special bottles.


    4. Good after-sales service.

    Tell me the package update, and will try best solve when customer encountered various problems.


    Shop China Supplier Teriparatide Acetate 52232-67-4 with Safe Custom high quality good price-Detailed Image 3


    Packaging & Shipping


    Shop China Supplier Teriparatide Acetate 52232-67-4 with Safe Custom high quality good price-Detailed Image 4


    Shop China Supplier Teriparatide Acetate 52232-67-4 with Safe Custom high quality good price-Detailed Image 5

     F.A.Q                                                                                                              

    • Q1 What’s your MOQ?

      A:Usually 1 kg,It’s depend on different products. We accept sample order. Also for

    • someproducts we can provide you with free sample.



    • Q2 How to control and quality assurance?

      a.High grade clean workshop.

      b. Inspection center equipped with instruments of HPLC, GC etc, R&D and QC for testing

    • of each batch.

      c. Cooperated with third-party test agency for testing heavy metals, pesticide

    • residues, allergen etc.



    • Q3 what kind of payment do you support?

      T/T, Trade Assurance, Paypal,Alipay, Credit Card, L/C etc.



    • Q4 What's your shipping methods and delivery time?

      a.Shipping Methods: DHL/Fedex/Air Shipping/Sea Shipping

      b.Shipping Time: 3-5 days by air or 7-14 days by sea



    • Q5 How to qaurantee the after-sale?

      a.We provide 24-hour customer service. If you encounter any product quality problems

    • or transportation problems, please feel free to contact us

    • b.lf any problem happens after sale, either quality or quantity, we will try to solve it

    • instantly.and we even have recall system if necessary.



    Certificates
    • TOP1 Good Quality Hormone Peptides Teriparatide Acetate CAS 52232-67-4 Teriparatide for sale Certificates 1

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    Parathyroid hormone human: fragment 1-34;parathyroid hormone (human, 1-34);parathyroid hormone (1-34), human;pth (1-34) (human);pth (human, 1-34);teriparatide;teriparatide acetate;

    CAS No.:

    52232-67-4

    Molecular Formula:

    C181H291N55O51S2.C2H4O2

    Molecular Weight:

    3890.49792

    EC Number:

    1533716-785-6

    HScode:

    2937190000

    Characteristics
    XLogP3:

    0.00000

    Appearance:

    powder

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Propylene glycol

    Location:

    No .41 Optics Valley Avenue, East Lake High-tech Development Zone, Wuhan ,China

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

    Nanjing Huaman Import and Export Co., Ltd was established in 2024 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products , mainly exported to the United States, Europe, India, South Africa, Nigeria and other countries and regions, has a wealth of export experience, to ensure transportation safety, can let each customer as soon as possible to safely receive the goods.
  • Inquiry History
    9 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.