Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 99%LL37 high purity LL37 CAS 154947-66-7 with factory price
99%LL37 high purity LL37 CAS 154947-66-7 with factory price buy - large image1
99%LL37 high purity LL37 CAS 154947-66-7 with factory price buy - image1
99%LL37 high purity LL37 CAS 154947-66-7 with factory price buy - image2
99%LL37 high purity LL37 CAS 154947-66-7 with factory price buy - image3
99%LL37 high purity LL37 CAS 154947-66-7 with factory price buy - image4
99%LL37 high purity LL37 CAS 154947-66-7 with factory price buy - image5

99%LL37 high purity LL37 CAS 154947-66-7 with factory price

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

1

Brand:

CX

Packaging:

5mg/vial,10mg/vial,20mg/vial,30mg/vial,10vials/box

Price valid (until):

2025-08-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Semaglutide,Retatrutide,Cosmetic peptides,Pharmaceutical peptides,Pharmaceutical interme

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager: Alex


    whatsapp:+852 98170061


    Email:njpeptide@gmail.com


    We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.


    Items Specifications
    Product name Peptide
    Appearance Lyophilized Powder
    Peptide Purity 99%
    Peptide Specification 1mg, 2mg, 5mg, 10mg, 15mg, 20mg, 30mg, 50mg, 100mg, 500mg etc in small vials
    Packaging Glass vials,10 vials/box
    Storage Cool Dry Place
    MOQ 1 box(10 vials)


    Elamipretide acetate is a small molecule polypeptide composed of four amino acids. In the body, elamipretide targets the inner membrane of mitochondria and can prevent oxidative damage to neurons and other cell types; prevent mitochondrial depolarization, reduce islet cell apoptosis, increase islet cell production, and improve post-transplantation function.
     
    Product Name  Elamipretide
    CAS NO. 97145-43-2
    Purity 99%
    Molecular Formula C32H49N9O5
    MOQ    10 vials


      about us 




    Our company was established in 2024. Our main products are various peptides,such as weight loss peptide, anti-wrinkle peptide, tanning titanium, and other products, reliable quality, committed to strict quality control and thoughtful customer service, our experienced staff is always available to discuss your requirements to ensure customer satisfaction.
    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.
    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.
    We therefore focus on sourcing materials of perfect quality and ensure strict internal process control.Our goal is to survive by quality and develop by reputation.
    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work
    In the past two years, our products have been spread across Europe, South America, North America, Southeast Asia, Africa and other more than 30 countries in the world. We work with friends all over the world to develop quality products, reasonable prices and safe and efficient transportation. Products are ordered in quantities ranging from milligrams to tons. Meet the new and old customers to buy.

    Shop 99%LL37 high purity LL37 CAS 154947-66-7 with factory price-Detailed Image 1 Shop 99%LL37 high purity LL37 CAS 154947-66-7 with factory price-Detailed Image 2 Shop 99%LL37 high purity LL37 CAS 154947-66-7 with factory price-Detailed Image 3 Shop 99%LL37 high purity LL37 CAS 154947-66-7 with factory price-Detailed Image 4 Shop 99%LL37 high purity LL37 CAS 154947-66-7 with factory price-Detailed Image 5  

    Why choose us?

    A frequently asked question. Professional and experienced.

    1) Rich export experience in Europe, North America, South America, the Middle East and Asia.

    2) Have rich experience in loading a large number of containers at Chinese seaports. Our advantages. 1) All purity >99%. 2) High quality and competitive prices.

    3) We are manufacturers and can provide high-quality products at factory prices. Delivery is fast and safe. Once the payment tracking number is available, the package can be dispatched within 24 hours.

    2) Safe and cautious transportation, with multiple transportation methods available for your selection. 3) The customs pass rate is over 99%. Our customers are spread all over the world. Professional services and rich experience make customers feel at ease, while sufficient inventory and prompt delivery meet their diverse needs.

    2) We will attach great importance to market feedback and product feedback. Meeting customers' requirements is our main responsibility. 3) High quality, competitive prices, prompt delivery and first-class service have won the trust and praise of all customers.

    How to handle your order:

    Step 1: Please tell me the products you like, the quantity and the destination country.

    Step 2: You confirm all the details and provide the purchase order.

    Step 3: We will send you the detailed prices of our products and provide suitable transportation methods for your reference. Step 4: Please confirm your order and payment 100% in advance and send us detailed contact information, including the contact person/company, address, mobile phone number, postal code and your special requirements.

    Step 5: We will arrange the shipment according to your requirements. After shipment, we will provide a tracking code, allowing you to track your package at any time.

    Step 6: After you receive the package, we will provide after-sales service

    Shop Semaglutide 10mg weight loss peptide Semaglutide peptide 10mg per vialGLP-1 Injection-Detailed Image 8 Shop Semaglutide 10mg weight loss peptide Semaglutide peptide 10mg per vialGLP-1 Injection-Detailed Image 9 Shop Semaglutide 10mg weight loss peptide Semaglutide peptide 10mg per vialGLP-1 Injection-Detailed Image 10

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Semaglutide,Retatrutide,Cosmetic peptides,Pharmaceutical peptides,Pharmaceutical interme

    Location:

    No.1, Renshan Road, Jiangpu Street, Nanjing City

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

    Our company was established in 2024. Our main products are various peptides,such as weight loss peptide, anti-wrinkle peptide, tanning titanium, and other products, reliable quality, committed to strict quality control and thoughtful customer service, our experienced staff is always available to discuss your requirements to ensure customer satisfaction.
    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.
    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.
    We therefore focus on sourcing materials of perfect quality and ensure strict internal process control.Our goal is to survive by quality and develop by reputation.
    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work
    In the past two years, our products have been spread across Europe, South America, North America, Southeast Asia, Africa and other more than 30 countries in the world. We work with friends all over the world to develop quality products, reasonable prices and safe and efficient transportation. Products are ordered in quantities ranging from milligrams to tons. Meet the new and old customers to buy.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.