Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - large image1
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - image1
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - image2
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - image3
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - image4
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - image5
Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price buy - image6

Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price

TDS 1 Inquiries

Unit Price:

$58/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GZ

Brand:

CaoQuan

Packaging:

5/10/15/20/30mg/vial,10vial/box

Price valid (until):

2029-11-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager:Bella
    whatsapp:+852 57150533
    Email:j17325602040@126.com

    sincerely look forward to your inquiries about our products.


      Product Detail  


    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Hazard Identification

    Classification of the substance or mixture

    Acute toxicity - Category 4, Oral

    Reproductive toxicity, Category 1A

    Hazardous to the aquatic environment, long-term (Chronic) - Category Chronic 4


    Items Specifications
    Product Name LL37
    Purity >99%
    Appearance White lyophilized powder
    CAS NO. 154947-66-7
    MNQ 1 box of 10 vials
    Application Weight loss



    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 1 Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 2



       Product effects  


      • 1. LL37 has been used as an antimicrobial agent to improve wound healing.

        2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

        3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

        4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

        5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

        6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.


    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 3 Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 4



      Company Profile 


    Changsha Caoquan Technology Co., Ltd. is a high-tech company specializing in the research and development and production of polypeptide drugs. The company has an advanced industrial chain, covering the research and development, approval and industrialization of peptide raw materials and preparations. Its products include innovative drugs, raw materials, enzymes used in medicine and green synthesis industry, functional peptides and protein products.
    Our core strengths are advanced polypeptide technology, strict quality control (conforming to cGMP standards), professional R&D team, and end-to-end solutions from raw materials to finished products.
    We are committed to providing customers with high-quality and high-value products and services and have established a good reputation in the global market. With excellent product quality, logistics service and customer-centered business philosophy, our products have been exported to more than 100 countries.
    Changsha Cao Quan is willing to maintain cooperative relations with old and new friends and create a better future together!

    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 5

    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 6


    Advantage 


    1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available .

    2. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    3. Special Service: Drop-shipping if need.

    4. Cheapest prices in the market, unbeatable!
    5. Double-clearance express, safer and more efficient.

    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 7

    FAQ

    Q1: When will the product be shipped after payment?
      ---We are committed to the same day shipping.

    Q2. How does your factory control quality?
    All the raw material purchasing and production quality control are strictly following the ISO9001: 2008 management system. Besides, the full-featured detection equipment and GMP quality management system provided the strongest guarantee for a high-quality product.


    Q3: How long will it take to receive the parcel?
       --3 days for the US market; 4-6 days for the others.

    Q4: What can I do if I don't have the ability to clear the custom?
       --We got experience after doing export for many years, so don't worry we can handle that.


      Product image


    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 8 Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 9


    Packaging & Shipping  


    Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 10 Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 11 Shop Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price-Detailed Image 12

    If you would like to inquire about other peptides, please contact me!

    Sales manager:Bella
    whatsapp:+852 57150533
    Email:j17325602040@126.com

    sincerely look forward to your inquiries about our products.

    Certificates
    • Large Quantity in Stock Peptides Ll37 CAS:154947-66-7 high Quality and Best Price Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cagrilintide,Tirzepatide,Semaglutide,Retatrutide,NAD+,Melatonine

    Location:

    Room 102, No. 60-20, Gongnong Street, Xiangya Road Subdistrict, Kaifu District, Changsha City, Hunan Province, China

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.