Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > High Quality Glucagon Peptide Powder CAS 120287-85-6
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - large image1
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - image1
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - image2
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - image3
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - image4
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - image5
High Quality Glucagon   Peptide Powder CAS 120287-85-6 buy - image6

High Quality Glucagon Peptide Powder CAS 120287-85-6

4 Inquiries

Unit Price: Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

98%

Port:

HK

Brand:

Shanxi Hongruichang International Trade LLC

Packaging:

sealed foil bag

Price valid (until):

2025-08-26

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cosmetic raw material,API,Fertilizer,Semaglutide,Tirzepatide,Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


       Product Detail  


    High Quality Glucagon 

    Peptide Powder CAS 120287-85-6

    Shop Raw Material Peptide Selank CAS 129954-34-3 10mg Vial instock-Detailed Image 1


    Shop High Quality Cetrorelix Peptide Powder CAS 120287-85-6-Detailed Image 2
    Shop High Quality Cetrorelix Peptide Powder CAS 120287-85-6-Detailed Image 3

    Shop High Quality Cetrorelix Peptide Powder CAS 120287-85-6-Detailed Image 4

    Shop High Quality Cetrorelix Peptide Powder CAS 120287-85-6-Detailed Image 5



       Why Choose US


    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. Provide samples before regular order. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 7

    Shop Top grade factory price Trizepatide, semaglutide and retraglutide in stock-Detailed Image 8

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 8 Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 9


       Package & Delivery


    Shop High Quality Cetrorelix Peptide Powder CAS 120287-85-6-Detailed Image 10

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 11


       FAQ  


    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price. 

    Q4: Do you accept VISA business credit card?

    A: We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel  lose.
    Our long association with  our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    Our clients will confirm this as even they struggle to find them without help at times.
    But in spite of our best efforts it is still possible  will seize a small number of packages.
    In this circumstance we promise reship free  to establish  long term relationship.



    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cosmetic raw material,API,Fertilizer,Semaglutide,Tirzepatide,Retatrutide

    Location:

    taiyuan

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2015

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.