Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder
Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder buy - large image1
Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder buy - image1
Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder buy - image2
Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder buy - image3
Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder buy - image4
Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder buy - image5

Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

CHINA ANY PORT

Brand:

TNJONE

Packaging:

10 Vial/Box, 5mg

Price valid (until):

2026-03-31

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,API,Vitamins,Food Additive

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Contact Information:
    Whatsapp :+86-18192264745
    Email :carine@tnjone.com


    Product Specification


    Items Specifications
    Product Name LL37 Peptides
    CAS 154947-66-7
    Molecular Formula
    /
    Appearance Lyophilized Powder


    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).


    Shop Hot selling LL37 Peptides with high quatity | CAS 154947-66-7 | 5mg vials Lyophilized Powder-Detailed Image 1

    Shop Peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 2


    About Us

    TNJONE specialize in the development and global distribution of high-quality research-use-only (RUO) raw materials, including peptides, small molecules, and biochemical reagents.

    Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.


    1. Superior Product Quality

        Product quality is the foundation of our business. Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

        Each batch includes a Certificate of Analysis (COA) with key data:
            • Purity (HPLC)
            • Molecular weight (MS)
            • Water content
            • Residual solvents
            • Microbial limit (if applicable)

        For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.


    2. Customization & R&D Support

        We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

        Our services include:
            • Custom peptide synthesis (mg to kg scale)
            • Peptide modifications and labeling
            • Small molecule synthesis
            • Project-based research and scale-up

        We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.


    Shop Peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 3 Shop Peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 4


    FAQ

    1.How to get in touch with us?

    You can chat with us by Trademanager,WhatsApp or simply giving us an email, a phone call. All our contacts information can be found from our website.


    2.Are you a manufacturer or trade company?

    We are a professional manufacturer.


    3.Can I get a sample?

    Yes, free sample can be provided, but shipping cost is covered by your side.


    4.What's your MOQ?

    It is based on the different product. Some are 1g while some are 1 kg. Please be free to consult our salesman.


    5.When can I get the quotation?
    We usually quote within 1 hours after we get your inquiry. If it's a urgent order you can call us or mention it in your email subject, and we can take it as priority.


    6.Is there any discount?
    Yes, some products are applied for discount, but it depends on the quantity.


    7.Can you do OEM for me?
    Yes,we accept OEM orders, just contact us and give us your requirement. We will offer you a reasonable price and make samples ASAP.


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,API,Vitamins,Food Additive

    Location:

    No. 4C-11-A392, Financial Port, Northwest corner of Fengjing Avenue and Fengxin Road, Fengdong New City, Xi 'an, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2019

    Shaanxi TNJONE Pharmaceutical Technology Co., LTD., located in the beautiful ancient capital Xi 'an, is committed to the peptide industry, pharmaceutical raw materials, food and feed additives, veterinary drugs and other fields, the enterprise adhering to provide customers with quality service, supply high-quality products, "world peace and health" as its responsibility, the company adhering to the "meet all customer requirements for products" as the service concept, Guarantee "provide qualified products" as the service principle, so that you get "God-like" noble shopping enjoyment. Our company has more than 1000 kinds of polypeptides, raw materials inventory, at any time to meet the various needs of customers for products. Is your best partner.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.