Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 peptide | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

COA TDS

Unit Price:

$50-60/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

QUNGDAO

Brand:

RL

Packaging:

5mg/10mg/15mg/20mg/30mg/60mg*10 vials/unit

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,retatrutide,Semaglutide

  • Product Description

  • Seller Information

  • Description


      Product Pictures   












    Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 1 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 2 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 3 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 4 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 5 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 6 Shop RL Cosmetic Grade Copper Peptide Powder Ghk-Cu CAS 49557-75-7 with Best Price-Detailed Image 7 Shop RL Cosmetic Grade Copper Peptide Powder Ghk-Cu CAS 49557-75-7 with Best Price-Detailed Image 8 Shop RL Cosmetic Grade Copper Peptide Powder Ghk-Cu CAS 49557-75-7 with Best Price-Detailed Image 9 Shop RL Cosmetic Grade Copper Peptide Powder Ghk-Cu CAS 49557-75-7 with Best Price-Detailed Image 10


       Product Detail    


    Product n ame Peptides
    Appearance Powder
    Purity 99%
    Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder.
    Shelf Life 24 Months
                                                  Reply inquiry within 12 hours
    Inquiry Items Pls send us what items and quantities you plan to purchase
    Quotation Quotation including the shipping cost details in total
    Payment methods Corfirm T/T, Trade assurance, according to the customer's requirements
    After payment Confirm the address after payment for shipment.
    Tracking Tracking number provided after shipment&Keep tracking
    Preparation time About 1-5 working days after payment
    Leading time About 8-15 days door to door
    After-sale service Within 6 hours

    FAQ

    Q1: How to place the order?
    A: Pls send the specification and quantities to by email or messages, and we check the order confirmation with you.

    Q: How long can I receive my package?
    A: The package will be shippied by special line shipping door to door; usually it will takes about 8-15 business days when you finished the payment.

    Q: What's your MOQ of your products?
    A: For the regular specification products, our MOQ is 1box.

    Q: Is there a discount?
    A: Yes, if you puchase in a large amount, we are glad to support with better price.

    Q: How to store it?
    A: Pls put it in cool dry place, we suggest you put them in cold storage for 2-5 degree condition.


      Customer feedback

     


    The following are genuine customer feedback reports; we don't fabricate anything.

    We treat our customers with 100% enthusiasm.

    If there's anything you're dissatisfied with, please feel free to raise it, and we'll make improvements.

    Welcome to order.

    Factory direct supply, low prices.

    Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 24 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 25 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 26 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 27 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 28


      About us 


    We are a professional enterprise specializing in the research and development and sales of high-quality peptide products, always prioritizing integrity and quality. We deeply understand that in the health and scientific research fields, every gram of our product is crucial to our clients' trust and the reliability of our results. Therefore, we solemnly promise that all our products come with authoritative Certificate of Analysis (COA) certification, ensuring traceability and verifiability at every stage from raw materials to finished products, with purity, content, and safety meeting stringent standards.


    As a trustworthy seller, we not only provide certificates but also treat every client with transparency and responsibility. Whether used in scientific research, pharmaceuticals, or health supplements, our peptide products undergo precise preparation and multiple quality checks, committed to providing you with stable, efficient, and reliable solutions.


    Choosing us means choosing quality assurance and peace of mind in our partnership. We look forward to becoming your trusted long-term partner through our professionalism and sincerity.

    Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 11 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 12 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 13 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 14 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 15 Shop RL MT-1 Peptide Super Quality CAS 75921-69-6 Manufacturer sell effective powder in stock-Detailed Image 16


      How to pack   


    Fast shipping, immediate dispatch.

    Orders are processed instantly, with lightning-fast delivery within 48 hours.

    Through partnerships with manufacturers and professional logistics providers, we ensure your desired goods arrive quickly and safely.

    Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 7 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 8 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 9 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 10 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 11 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 12 Shop RL Wholesale Peptide Blend GHK-Cu Blue Copper Lyophilized Powder in stock-Detailed Image 13


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,retatrutide,Semaglutide

    Location:

    Room 2008, 20th Floor, Unit 2, Building 15, No. 152, Dongsanmalu, Guancheng Hui District, Zhengzhou City, Henan Province

    Average lead Time:

    15

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2024


      Company Profile  


    About Us
    We have been a professional peptide product manufacturer and have overseas warehouses in the United States, Canada and Australia, which are shipped on the same day. Our products are exported to the United States, Canada, Mexico, Australia, the Netherlands, Germany, and other countries. Equipped with state-of-the-art laboratory facilities and cutting-edge production technologies, we uphold the principle of "Quality Primacy" and the philosophy of "Customer Sovereignty" in developing superior biological solutions.

    OEM/ODM Services Available
    Our core competitiveness is rooted in a production system certified by both GMP and ISO. We ensure that our products meet international standards through full-process quality control management. Moreover, by relying on our scientific research and development system, we achieve optimal efficiency in production output. In response to the demands of brand customers, we have specially developed tailored production solutions. Through the OEM/ODM service model, we provide personalized product development plans for our brand enterprises.

    Service Assurance Protocol
    We pledge to ensure the secure transit of client consignments with guaranteed delivery precision. Should any shipment discrepancy occur, our comprehensive compensation policy ensures 100% value reimbursement, coupled with expedited replacement arrangements within 8 business hours.

    Win-win Cooperation
    We cordially invite global partners to witness firsthand how biotechnology is revolutionizing the beauty and wellness industries. At RUNLIAN, every molecular formula embodies the ingenuity of intelligent manufacturing, and every collaboration initiates a new chapter of mutual success. As our founder emphasizes, "We bridge dreams with reality through science, demonstrating China's biotechnological prowess to the world."

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.