 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8 buy - large image1

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8 buy - image1

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8 buy - image2

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8 buy - image3

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8 buy - image4

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8

TDS 1 Inquiries

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

HORLDEN

Packaging:

1 Gram or 1 Box

Price valid (until):

2025-12-31

Contact Supplier

 Chat Now

XI'AN HORLDEN BIO INDUSTRIES INC

Company Type:

Manufactory

Location:

China

Qualification:

Main Products:

Chemical,Intermediate,5-amino-1mq,SLU-PP332,Tirzepatide,Peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Shop Spot supply 10mg vial Tirzepatide powder CAS 2023788-19-2 Tirzepatise-Detailed Image 1

You can ask us for quotation and product information via Email, Phone, WhatsApp and other channels.

Email: christy@horlden.com
WhatsApp: +86 13572531251

！！！ Welcome to consult ！！！

Shop Spot supply 10mg vial Tirzepatide powder CAS 2023788-19-2 Tirzepatise-Detailed Image 2

Product Name:	LL-37	Cas No.	0
Purity:	99%	Shipment	after payment 1-2 days
Package:	Foil Bag	Delivery	7-15 days
MOQ	1 Gram or 1 Box	Service	Door to door
Transportation:	By Air	Grade Standard	Top Quality
Sample	Availiable	Shelf Life	2 Years

LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing

Shop Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8-Detailed Image 3

Shop Spot supply 10mg vial Tirzepatide powder CAS 2023788-19-2 Tirzepatise-Detailed Image 4

1.What's your payment terms?

Standard terms: T/T in advance. Also L/C at sight is acceptable for large amount.

2.What's your shipping time?

We have bulk in stock, which means we can ship it to you immediately.

3.How do you ensure the quality of your products?

Strict QC with 6 steps testing from raw material purchase to finished product.

4.How do you ship the order normally?

For large qty order,ship the goods by sea. For small qty order, by air or express. We supply optional express for you, including DHL, FEDEX,UPS,TXT,EMS,and so on.

5.What's your loading port?

Usually Beijing, Shanghai, Qingdao, Tianjin, Guangzhou

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Manufactory

Main Products:
Chemical,Intermediate,5-amino-1mq,SLU-PP332,Tirzepatide,Peptide

Location:
10712，floor7,Unit 1,Buiding5,Silk Road International Creative Dreamwordks,No.3639,xi'an,shaanxi

Payment Terms:
100% TT in advance

Average lead Time:
7

Total Annual Revenue:
$2.5 million-$5 million

Total Employees:
11-50

Year of Establishment:
2015

Xi'an Horlden Bio Industries Ins is committed to promoting health application products such as chemical daily necessities, APIs, pharmaceutical intermediates and Cosmetic raw materials.

We have established friendly business relationships with hundreds of customers from over 50 countries and regions. Our team is committed to providing customers with the highest quality products at reasonable prices and satisfactory service. For many years, our company has won the trust and favor of our customers with high-quality products, first-class services, and competitive prices.

We will create the highest quality and most stable supply channel for customers, adhering to the spirit of serving customers, relying on strong funds and good cooperation reputation in the industry, to provide customers with higher quality products and services. At the same time, we are willing to strengthen exchanges and sincere cooperation with domestic and foreign merchants to create a better future together. It is your best supplier.

Welcome to Xi'an Horlden Bio Industries Ins !

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37	Pharmaceutical Grade/99		Haikou Mingheng	Inquiry
SLU-PP-322 IP10 MS10 MS40 322 ET10 ET50 CAS154947-66-7 The price is the factory price	Pharmaceutical Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price	Pharmaceutical Grade/99	$12-13/BOU FOB	Hangzhou Zhongshuan Technology Co., Ltd.	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

Large Quantity in Stock Peptides Ll37 CAS 154947-66-7 LL-37 Human cathelicidin 597562-32-8

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches