Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL37 high purity and High Quality
LL37 high purity and High Quality buy - large image1
LL37 high purity and High Quality buy - image1
LL37 high purity and High Quality buy - image2
LL37 high purity and High Quality buy - image3
LL37 high purity and High Quality buy - image4
LL37 high purity and High Quality buy - image5
LL37 high purity and High Quality buy - image6

LL37 high purity and High Quality

TDS 1 Inquiries

Unit Price:

$115/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

Guangsheng

Packaging:

10mg*10vials; 15mg*10vials; 20mg*10vials; 40mg*10vials

Price valid (until):

2030-11-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

beaty prodt

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name:  Lynn
    Wechat:  15914422644

    Tel:+86  15914422644

    Whatsapp: +852 6252 8290

    Email:    guangsheng 5   @zgguangsheng.com

    1. Core Molecular & Physicochemical Specifications


    Item Details
    Amino Acid Sequence [LL-37, 37 aa]
    Molecular Formula C₂₀₀H₃₁₆N₅₈O₄₉
    Molecular Weight 4493.2 Da
    CAS Number 254697-78-4
    Purity Standard Research‑grade ≥98% (HPLC); custom synthesis available for ≥99%
    Formulation White lyophilized powder; soluble in water (≥5 mg/mL) and aqueous buffers
    Isoelectric Point (pI) ~10.5 (cationic at physiological pH)
    Stability Stable at −20°C for 2–3 years (sealed, desiccated); reconstituted solution stable at 4°C for 1–2 weeks
    Key Quality Metrics Endotoxin ≤0.1 EU/mg; moisture ≤0.5%; heavy metals ≤10 ppm



    2. Mechanism of Action


    LL37 acts via multi‑target coordination across microbial killing, immune regulation, and tissue repair:

    1. Antimicrobial Activity:
      • Membrane disruption: “Carpet model” or “barrel‑stave pore formation” disrupts bacterial/fungal membranes via electrostatic interactions with anionic phospholipids.
      • Endotoxin neutralization: Binds LPS/LTA to block TLR4/TLR2 activation, reducing sepsis risk.
      • Biofilm dissolution: Disperses mature biofilms and inhibits quorum sensing in Gram‑positive/negative bacteria.

    2. Immunomodulation:
      • Chemotaxis: Recruits neutrophils, monocytes, and T cells via FPRL1 receptor.
      • TLR signaling balance: Inhibits TLR2/TLR4 (lipid agonists) while enhancing TLR3/TLR7–TLR9 (nucleic acid agonists) via nucleic acid complexation.
      • Inflammasome regulation: Blocks AIM2 inflammasome assembly via LL37–DNA complex steric hindrance.

    3. Tissue Repair: Stimulates VEGF secretion and epithelial/endothelial cell migration to promote angiogenesis and wound closure.



    3. Biological Functions & Application Fields


    3.1 Core Physiological Effects


    • Broad‑Spectrum Pathogen Killing: Active against Gram‑positive (S. aureus) and Gram‑negative (E. coli) bacteria, fungi (C. albicans), and enveloped viruses (HIV‑1, influenza).
    • Inflammation Resolution: Mitigates LPS‑induced sepsis, reduces pro‑inflammatory cytokines (TNF‑α, IL‑6), and enhances anti‑inflammatory IL‑10 release.
    • Wound & Tissue Regeneration: Accelerates re‑epithelialization, angiogenesis, and collagen deposition; reduces scarring.
    • Anti‑Cancer Potential: Induces cancer cell apoptosis and inhibits metastasis via membrane permeabilization and signaling modulation.

    3.2 Application Fields


    Field Usage Scenarios
    Infectious Disease Research Preclinical models of antibiotic‑resistant bacterial infections, sepsis, and viral pneumonia.
    Wound Care Development Topical formulations for chronic ulcers, burn healing, and post‑surgical recovery.
    Inflammatory Disorders Studies on psoriasis, atopic dermatitis, and COPD via immune modulation.
    Antimicrobial Stewardship Development of AMP‑based therapeutics to combat multi‑drug resistance.



    4. Production & Quality Control


    4.1 Manufacturing Processes


    1. Precursor & Synthesis: Precursor hCAP18 is processed by serine protease 3/kallikrein 5 to yield LL37; synthetic production uses Fmoc SPPS with C18 RP‑HPLC purification.
    2. Lyophilization: Purified peptide is lyophilized to a stable powder and vacuum‑sealed with desiccant to avoid moisture‑induced degradation.
    3. Quality Validation: Identity confirmed via mass spectrometry; purity verified by HPLC; endotoxin tested via LAL assay.

    4.2 Quality Testing Standards


    Test Item Specification Detection Method
    Purity ≥98% (Research Grade) RP‑HPLC (C18 column, 214 nm, acetonitrile/water with 0.1% TFA)
    Identity Matches reference standard LC‑MS, amino acid analysis
    Endotoxin ≤0.1 EU/mg LAL chromogenic assay
    Moisture ≤0.5% Karl Fischer titration
    Heavy Metals ≤10 ppm ICP‑MS



    5. Administration, Safety & Regulatory Status


    5.1 Administration Routes & Dosage


    • Preclinical Injection: Intraperitoneal (IP) 1–5 mg/kg/day; subcutaneous (SC) 0.5–2 mg/kg 3×/week for systemic infection models.
    • Topical Use: 0.1%–1% peptide in hydrogel/cream for wound healing studies; applied twice daily.
    • Cell Culture: 0.1–10 μM for antimicrobial or immune signaling assays.

    5.2 Safety Profile


    • Low Toxicity: LD₅₀ > 100 mg/kg in rodents; minimal hemolysis at therapeutic concentrations.
    • Side Effects: Transient local irritation at injection sites; no off‑target organ damage reported in preclinical studies.
    • Contraindications: Hypersensitivity to LL37; caution in pregnant/lactating animals (limited data).
    • Regulatory Status: Research use only; no FDA‑approved human therapeutics yet (2026).

    5.3 Handling Guidelines


    • Storage: Lyophilized powder at −20°C; reconstituted solution at 4°C (avoid repeated freeze–thaw cycles).
    • Reconstitution: Use sterile water or PBS (pH 7.0–7.4); avoid high‑salt buffers to prevent aggregation.
    • Transport: Cold chain (2–8°C) to maintain stability.



    6. Key Advantages & Limitations


    6.1 Advantages


    1. Multi‑Functional Activity: Combines antimicrobial, anti‑inflammatory, and tissue‑repair effects, outperforming single‑target agents.
    2. Resistance‑Resistant: Membrane‑disruptive mechanism reduces likelihood of microbial resistance compared to traditional antibiotics.
    3. Immune Homeostasis: Balances pro‑ and anti‑inflammatory pathways to avoid excessive inflammation.
    4. Broad Tissue Utility: Effective in skin, respiratory, and gastrointestinal models, supporting cross‑disciplinary research.

    6.2 Limitations


    1. Short Half‑Life: Plasma half‑life ~30–60 minutes; requires frequent dosing or sustained‑release formulations.
    2. Salt Sensitivity: Cationic charge leads to aggregation in high‑salt environments, reducing activity.
    3. Dual Role in Disease: May exacerbate autoimmune diseases (e.g., psoriasis) via TLR activation in some contexts.



     About Us 


    Shop Top Quality AHK-CU-Detailed Image 1
    Shop Top Quality AHK-CU-Detailed Image 2
    Shop Top Quality AHK-CU-Detailed Image 3



      Product Detail  


    1. Molecular & Physical Properties

    • Amino Acid Sequence: Ala-His-Lys-Cu, formed by chelating the tripeptide alanyl-histidyl-lysine with copper ions.
    • Purity: ≥99% (HPLC verified), ensuring high bioactivity and minimal impurities.
    • Physical Appearance: Deep blue lyophilized powder, highly water-soluble for easy formulation into solutions, creams, or injectables.
    • Stability: Optimal storage at -20℃; stable for 24 months when sealed from light and moisture; avoid high temperatures to prevent copper ion dissociation.

    2. Core Biological Mechanisms

    • Collagen & Elastin Synthesis: It upregulates the expression of TGF-β and matrix metalloproteinase inhibitors (TIMPs), stimulating fibroblasts to produce type I/III collagen and elastin. This enhances skin elasticity, reduces fine lines, and improves skin texture.
    • Antioxidant & Anti-inflammatory Effects: The copper ion moiety scavenges free radicals (e.g., superoxide anion, hydroxyl radicals) to mitigate oxidative stress. It also inhibits NF-κB pathways, reducing the release of pro-inflammatory cytokines (TNF-α, IL-6) and alleviating tissue inflammation.
    • Hair Follicle Activation: It extends the anagen (growth) phase of hair follicles, increases dermal papilla cell proliferation, and improves microcirculation around hair follicles, which aids in reversing hair miniaturization associated with androgenetic alopecia.
    • Wound Healing Acceleration: By promoting angiogenesis and fibroblast migration, it speeds up granulation tissue formation and epithelialization, shortening recovery time for acute and chronic wounds (e.g., burns, diabetic ulcers).

    3. Application Scenarios

    • Dermatological Cosmetics: Added to anti-aging serums, creams, and masks to improve skin firmness, fade wrinkles, and repair photodamaged skin.
    • Trichological Research: Used in topical formulations or scalp injections for androgenetic alopecia treatment and hair regrowth studies.
    • Regenerative Medicine: Applied in wound care dressings and tissue engineering scaffolds to enhance skin and soft tissue repair.
    • Laboratory Research: Serves as a tool compound for studying copper peptide biology, oxidative stress, and tissue regeneration mechanisms.

    4. Safety & Advantages

    • Non-immunogenic, with no reported allergic reactions or systemic side effects in topical use.
    • Biodegradable, breaking down into natural amino acids and copper ions that are metabolized by the body.
    • Compatible with most cosmetic and pharmaceutical excipients (e.g., hyaluronic acid, glycerin), suitable for multi-component formulations.


      Product Detail  


    Shop Top Quality AHK-CU-Detailed Image 4
    Shop Top Quality AHK-CU-Detailed Image 5
    Shop Top Quality AHK-CU-Detailed Image 6

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    beaty prodt

    Location:

    Yongtai Jinli City Plaza, Baiyun District, Guangzhou City, Guangdong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    30

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2023

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.