 Home > Chemical Reagents > Organic Reagents > LL-37 for Sale > US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder buy - large image1

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder buy - image1

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder buy - image2

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder buy - image3

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder buy - image4

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder

Unit Price:

$8-10/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

qingdao

Brand:

peptide

Packaging:

5mg 10mg 15mg 20mg 25mg 30mg 50mg

Price valid (until):

2027-02-28

Contact Supplier

 Chat Now

Tianjin Obos Cosmetics Co., Ltd

Company Type:

Trader

Location:

China

Qualification:

Main Products:

peptide

 Visit Store

Product Description
Seller Information

Description

Product Detail

Contact me：Mila LI

WhatsApp：+852 54241848

Enjoy separate quick quotes and discounts after adding

Items	Specifications
Appearance	White powder
Purity	99%
Packaging	Glass vials，10 vials/box
Shelf Life	24 Months
MOQ	1 box（10 vials）
Storage	Cool Dry Place

Shop Various Peptides China Supply Peptide High Purity 2023788-19-2 tirzepatide Loss Weight 10mg 20mg VialsPeptide-Detailed Image 1

About the product

We specialize in exporting various peptides for 20+ years, such as Tirzepatide，Semaglutide，Retatrutide，NAD/NAD+，GHK-CU，TB500，Glutathione，Melanotan II，Cagrilintide，IGF-1 LR3，HCG，MOTS-C etc hot selling peptide and Bacteriostatic water.

Our products are often sold to Europe, North America, Southeast Asia, and other countries and regions. Sample orders are welcome. We can supply samples for testing.We provide high-quality products and services.

Why choose us?

Professional, Rich Experience

1)Rich experience for Europe&North America&South America&Middle East&Asiaexport.

2)Full experience of large numbers containers loading in Chinese sea port.

Our Advantages.

1)All purity>99%.

2)High quality with competitive price.

3)We are manufacturer and can provide high quality products with factory price.

Fast and safe delivery.

1)Parcel can be sent out in 24 hours after payment tracking number available.

2)Secure and discreet shipment verious transportation methods for your choice.

3)Customs pass rate >99%.

We have clients throughout the world.

1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

Shop Various Peptides China Supply Peptide High Purity 2023788-19-2 tirzepatide Loss Weight 10mg 20mg VialsPeptide-Detailed Image 4

Shop Various Peptides China Supply Peptide High Purity 2023788-19-2 tirzepatide Loss Weight 10mg 20mg VialsPeptide-Detailed Image 5

Our services :

product quality

1)Product has COA, and HPLC testing report

2)Our factory is ISO9001 standard

3)We have the great reviews from customers

OEM service:

1）Customized logo

2）Customized label, packing box as customer's requirement

3）Cap color can be customized

4）Shipping service:

5）Goods shipped in 1-5 days after payment.

6）Shipping fast and safe in about 8-15 days

7）We can do special packing

8）Tracking number is offered after ordering

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Organic Reagents

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
peptide

Location:
Room 3293, No. 2 Yuan Yuan Road, Yangcun Street, Wuqing District, Tianjin City

Payment Terms:
TT against copy of documents,D/P,100% TT in advance

Average lead Time:
10

Year of Establishment:
2025

Certifications:
COA

Tianjin Aobos Cosmetics Co., Ltd
Country Product Purchase Quantity Date Posted

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 375mg	Pharmaceutical Grade/99	$100-115/UNIT FOB	Guangzhou Henghuang Trading Co., Ltd.	Inquiry
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37	Pharmaceutical Grade/99		Haikou Mingheng	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry

US Warehouse Semaglutide 99% Purity|10mg15mg 20mg 30mg Vials |Lyophilized Powder

Product Description

Seller Information

More Choices Find All Products for Sale 

Related Searches