Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Emollient > LL-37 for Sale > In-House Produced High-Purity LL-37 Fast Shipping Chinese Manufacturer
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - large image1
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - image1
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - image2
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - image3
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - image4
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - image5
In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer buy - image6

In-House Produced High-Purity LL-37 Fast Shipping Chinese Manufacturer

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

CT

Packaging:

Small bottles, or as per customer requirements

Price valid (until):

2026-11-30

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    WhatsApp:+852 6462 7346

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 1

    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 2

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 3 Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 4

    Items Specifications
    name LL37
    purity 99%
    Exterior Powdery


    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 5

    1. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    2. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 6 Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 7 Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 8

    Why choose us?

    A frequently asked question. Professional and experienced.

    1) Rich export experience in Europe, North America, South America, the Middle East and Asia.

    2) Have rich experience in loading a large number of containers at Chinese seaports. Our advantages. 1) All purity >99%. 2) High quality and competitive prices.

    3) We are manufacturers and can provide high-quality products at factory prices. Delivery is fast and safe. Once the payment tracking number is available, the package can be dispatched within 24 hours.

    2) Safe and cautious transportation, with multiple transportation methods available for your selection. 3) The customs pass rate is over 99%. Our customers are spread all over the world. Professional services and rich experience make customers feel at ease, while sufficient inventory and prompt delivery meet their diverse needs.

    2) We will attach great importance to market feedback and product feedback. Meeting customers' requirements is our main responsibility. 3) High quality, competitive prices, prompt delivery and first-class service have won the trust and praise of all customers.

    How to handle your order:

    Step 1: Please tell me the products you like, the quantity and the destination country.

    Step 2: You confirm all the details and provide the purchase order.

    Step 3: We will send you the detailed prices of our products and provide suitable transportation methods for your reference. Step 4: Please confirm your order and payment 100% in advance and send us detailed contact information, including the contact person/company, address, mobile phone number, postal code and your special requirements.

    Step 5: We will arrange the shipment according to your requirements. After shipment, we will provide a tracking code, allowing you to track your package at any time.

    Step 6: After you receive the package, we will provide after-sales service

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 9

    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 10


    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Shop In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer-Detailed Image 11

    Certificates
    • In-House Produced High-Purity LL-37  Fast Shipping Chinese Manufacturer Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Emollient

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.