Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Emollient > LL-37 for Sale > LL-37 Direct from Manufacturer Ultra-High Purity Fast Shipping
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - large image1
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - image1
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - image2
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - image3
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - image4
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - image5
LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping buy - image6

LL-37 Direct from Manufacturer Ultra-High Purity Fast Shipping

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

CT

Packaging:

Small bottles or as per customer requirements

Price valid (until):

2027-03-30

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


    WhatsApp:+852 6462 7346


    Items Specifications
    Name LL37
    Purity  99%
    Color White


    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 1

    Name: LL37 5mg

    Purity: >99% (or refer to the Certificate of Analysis)

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.
    CAS Number: 154947-66-7
    It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.


    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 2

    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity, ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 3

    1. Company Introduction:

    Our company specializes in exporting various chemical products, including chemical raw materials, a full range of peptide products.

    We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.

    2. Product Description:

    Peptides are short chains of 2–50 amino acids linked by peptide bonds, bridging amino acids and proteins. They feature high absorption rate (80%–95%), strong biological activity, low immunogenicity, and wide applications in pharmaceuticals, cosmetics, nutraceuticals, and research.

    3. Key Categories:

    - Cosmetic Peptides: Acetyl Hexapeptide-8, Copper Peptide GHK-Cu, Pentapeptide-4, SNAP-8
    - Pharmaceutical Peptides: Semaglutide, Tirzepatide, Thymosin Alpha-1, Epithalon

    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 4

    4. Specifications:

    - Purity: ≥99% (HPLC)
    - Appearance: White to off-white lyophilized powder
    - Solubility: Soluble in water, DMSO, etc.
    - Storage: -20°C, dry and protected from light
    - Minimum order quantity: 1 box
    - COA provided; factory direct supply; stable quality; fast delivery

    5. Applications:

    - Cosmetics: Anti-wrinkle, firming, whitening, repair
    - Pharmaceuticals: Weight management, immune regulation
    - Nutritional supplements: Sports nutrition, anti-aging, health supplements
    - Scientific research: Laboratory reagents, custom synthesis

    6. Why Choose Us:

    - Factory direct, competitive FOB price
    - Strict quality control, full COA
    - Custom synthesis & packaging available
    - Fast delivery & professional after-sales

    Contact us for best quotation!

    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 5

    7. peptides have obvious advantages:

    - Direct absorption without digestion
    - Strong targeting and physiological activity
    - Stable structure, easy to process and formulate
    - High safety, good biocompatibility

    These properties make peptides one of the most promising raw materials in the global health and beauty industry.

    8.Main Functions & Benefits

    - Anti-aging & anti-wrinkle
    Reduce fine lines, firm skin, promote collagen regeneration.
    - Skin repair & protection
    Accelerate wound healing, soothe sensitive skin, reduce inflammation.
    - Weight management & metabolism
    Regulate appetite, improve insulin sensitivity, support fat metabolism.

    We are a professional peptide manufacturer and supplier with rich experience in global export.
    We provide high-quality peptides, stable supply, and professional service for worldwide customers.
    Welcome to contact us for price list, COA and more details.

    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 6
    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 7
    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 8
    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 9
    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 10
    Shop LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping-Detailed Image 11

    Certificates
    • LL-37  Direct from Manufacturer  Ultra-High Purity  Fast Shipping Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Emollient

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.