Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Emollient > LL-37 for Sale > LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - large image1
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - image1
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - image2
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - image3
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - image4
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - image5
LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price buy - image6

LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shenzhen

Brand:

CT

Packaging:

Small bottles, packaged according to customer requirements

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    Description


    WhatsApp:+85292488945

    Product Detail 


    1. LL37 has been used as an antimicrobial agent to improve wound healing.

    2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.


    3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.


    4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.


    5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.


    6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 1
    Items Specifications

    Appearance

    White Powder

    Purity

    99%

    Storage condition

    -20℃
    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 2


    1. Ultra-High Purity  
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency

    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing

    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.



    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 3


    The importance of peptides:



    Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.


    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 4

    1. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    2. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.


    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 5

    1. Expertise in Peptide Synthesis


    Extensive Experience: 7 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.

    2. Advanced Manufacturing Capabilities


    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.


    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    3. Innovation & Customer Commitment


    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.


    4. Ultra-High Purity  


    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.


    5.Accurate Dosing & Consistency


    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    6.Endotoxin-Free & Sterile Processing


    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 6
    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 7

    Why Choose Our Peptides?

    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .


    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .



    • Why Partner with us?


    • Quality Assurance:  

    • Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.


    • Flexible Supply:  

    • Available in multiple formats. Consistent lead times with flexible production capacity.


    • Competitive Edge:  

    • Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.


    • Technical Support:  

    • Full documentation and formulation guidance.


    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 8

    FAQ

    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email.

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price.

    Q4: Do you accept VISA business credit card?

    A: Sorry we don't accept VISA credit card,

    We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.

    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.

    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel lose.

    Our long association with our clients has brought great benefits.

    We always take the upmost care in the packaging of our products .

    Our clients will confirm this as even they struggle to find them without help at times.

    But in spite of our best efforts it is still possible will seize a small number of packages.

    In this circumstance we promise reship free to establish long term relationship.



    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 9


    How to handle your order:


    Step 1: Please tell me the products you like, the quantity and the destination country.

    Step 2: You confirm all the details and provide the purchase order.

    Step 3: We will send you the detailed prices of our products and provide suitable transportation methods for your reference. Step 4: Please confirm your order and payment 100% in advance and send us detailed contact information, including the contact person/company, address, mobile phone number, postal code and your special requirements.

    Step 5: We will arrange the shipment according to your requirements. After shipment, we will provide a tracking code, allowing you to track your package at any time.



    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 10


    Why choose us?



    A frequently asked question. Professional and experienced.

    1) Rich export experience in Europe, North America, South America, the Middle East and Asia.

    2) Have rich experience in loading a large number of containers at Chinese seaports. Our advantages. 1) All purity >99%. 2) High quality and competitive prices.

    3) We are manufacturers and can provide high-quality products at factory prices. Delivery is fast and safe. Once the payment tracking number is available, the package can be dispatched within 24 hours.

    2) Safe and cautious transportation, with multiple transportation methods available for your selection. 3) The customs pass rate is over 99%. Our customers are spread all over the world. Professional services and rich experience make customers feel at ease, while sufficient inventory and prompt delivery meet their diverse needs.

    2) We will attach great importance to market feedback and product fe edback. Meeting customers' requirements is our main responsibility. 3) High quality, competitive prices, prompt delivery and first-class service have won the trust and praise of all customers.




    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 11

    Company Profile


    We are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.

    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.

    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.



    Shop LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price-Detailed Image 12

    Certificates
    • LL37 high-quality freeze-dried powder, sold by the manufacturer, wholesale price Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Emollient

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.